KEGG   Mus musculus (mouse): 242687
Entry
242687            CDS       T01002                                 

Gene name
Wasf2, AW742646, D4Ertd13, D4Ertd13e, WAV, WAVE2
Definition
(RefSeq) WASP family, member 2
  KO
K05748  WAS protein family, member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04520  Adherens junction
mmu04666  Fc gamma R-mediated phagocytosis
mmu04810  Regulation of actin cytoskeleton
mmu05100  Bacterial invasion of epithelial cells
mmu05135  Yersinia infection
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    242687 (Wasf2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    242687 (Wasf2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    242687 (Wasf2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    242687 (Wasf2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    242687 (Wasf2)
   05100 Bacterial invasion of epithelial cells
    242687 (Wasf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    242687 (Wasf2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     242687 (Wasf2)
SSDB
Motif
Pfam: WH2 WASH_WAHD
Other DBs
NCBI-GeneID: 242687
NCBI-ProteinID: NP_700472
MGI: 1098641
Ensembl: ENSMUSG00000028868
Vega: OTTMUSG00000010477
UniProt: Q8BH43
Position
4 D2.3; 4 66.22 cM
AA seq 497 aa
MPLVTRNIEPRHLCRQTLPSDTSELECRTNITLANVIRQLGSLSKYAEDIFGEICTQASA
FASRVNSLAERVDRVQVKVTQLDPKEEEVSLQGINTRKAFRSSTTQDQKLFDRNSLPVPV
LETYNSCDAPPPLNNLSPYRDDGKEALKFYTNPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKERLGPSGYSSTLVYQNGSIGSVEN
VDAASYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPADNQRGSVLAGPKRTSMVSPSHP
PPAPPLSSPPGPKPGFAPPPAPPPPPPMSVPPPLPSMGFGSPGTPPPPSPPSFPPHPDFA
APPPPPPPPAADYPMPPPPLSQPSGGAPPPPPPPPPPGPPPLPFSGADGQPAAPPPPPPS
EATKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEY
SDSEDDSSEFDEDDWSD
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgccgttagtaaccaggaacatcgagccaaggcacctgtgccgtcagacgttgcctagc
gatacaagcgagctggaatgcaggaccaacatcaccctggcaaatgtcatccgacagctg
ggcagcctgagtaagtatgcagaggacattttcggagagatttgtactcaggcaagtgcc
tttgcctcccgagtaaactcccttgctgagcgggttgaccgagtacaagttaaagtcact
cagctggatcccaaggaagaagaagtgtcactacaaggaatcaacactcggaaggccttc
agaagttctaccacccaagaccagaagctctttgacaggaactctctcccggtgcccgtc
ttagagacctataacagctgtgacgctcctccccctcttaacaatctcagtccttacagg
gacgatggaaaagaggcactcaaattctacaccaacccctcatacttctttgatctttgg
aaggagaagatgctgcaggacaccaaggatatcatgaaagagaagagaaagcataggaaa
gaaaagaaagataatccaaatagagggaatgtgaacccacgtaaaatcaagacacgcaag
gaagagtgggagaagatgaaaatgggacaagaatttgtagagtccaaggagaggctgggg
ccttctgggtattcgtccaccttggtgtaccagaatggcagcattggctctgttgaaaat
gtggatgcggccagctacccaccaccaccacagtcggactctgcctcctcaccttcccct
tcattctctgaagacaacttgcctcccccgccagcagaattcagctaccctgcagacaac
caaagaggatctgtcttggctggacccaaaagaaccagcatggtcagcccaagccatcca
cccccagctcctcctctgagctctccgccaggtcccaagcctggcttcgctcctccacct
gcccctccacctccacctcccatgagtgtgccacctccactaccatcgatgggattcggg
tctcctgggacccctccacccccatcacctccatctttccctcctcaccctgattttgct
gctcctccaccacctcccccaccaccagcagctgactacccaatgccaccacctcctttg
tcccaaccgtctggaggtgctcctccgcctcctcctccccctccccctccagggcccccg
cctctccccttcagcggtgctgatggccagcctgctgcaccaccaccaccaccaccttct
gaggccaccaagcccaagtcttcattgcctgctgtgagtgacgcgcgcagtgacctgctt
tctgccattcgccaaggctttcagctgcgaagggttgaagagcaacgggagcaagagaag
cgtgatgtggtgggcaatgatgtggccaccatcctgtcccgtcggatcgctgttgagtac
agcgactcggaagatgattcttctgaatttgatgaagacgactggtcggattaa

DBGET integrated database retrieval system