KEGG   Mus musculus (mouse): 242735Help
Entry
242735            CDS       T01002                                 

Gene name
Lrrc38, A230053A07Rik
Definition
(RefSeq) leucine rich repeat containing 38
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT
Motif
Other DBs
NCBI-GeneID: 242735
NCBI-ProteinID: NP_001156455
MGI: 2442845
Ensembl: ENSMUSG00000028584
Vega: OTTMUSG00000010227
UniProt: A2VDH3
Position
4; 4 E1
AA seq 298 aa AA seqDB search
MSLCVAPRHPTGAAAALGLGSLLVLLGPGRACPAGCACTDPHTVDCRDRGLPSVPDPFPL
DVRKLLVAGNRIQQIPEDFFIFHGDLVYLDFRNNSLRSLEEGTFSGSGKLAFLDLSYNNL
TQLGAGAFRSAGRLVKLSLANNHLAGVHEAAFESLESLQVLELNDNNLRSLNVAALDALP
ALRTVRLDGNPWLCDCDFAHLFSWIQENTSKLPKGLDAIQCSLPMEDRRVALRELSEASF
SECKFSLSLTDLFIIIFSGVAVSIAAIISSFFLATVVQCFQRCAPNKDTEDEDDDEDD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagtctctgcgttgccccccgccaccccacgggcgctgctgcggcgctggggctcggt
agcctcttggtgctgctcgggccgggacgcgcgtgccccgcgggctgtgcttgcaccgac
ccccataccgtggactgtcgcgatcgcgggctgcccagcgtgcccgatcccttccccctg
gacgtgcgcaagctgctagtggccggcaaccgcatccagcagatccccgaggacttcttc
atcttccatggagatctggtgtatctggatttcaggaacaactcgctgcgctcgctggag
gagggcacgttcagcggctcgggcaagctggcctttctggacctgagctacaacaacctc
acccagctgggggccggcgccttccgctcggcggggaggctggtcaagctgagcctggcc
aacaaccatctggccggtgtacatgaggctgccttcgagagcctggagtccttgcaggtg
ctggaactcaacgacaacaacctgcgcagcctcaacgtggcggctttggatgcgctgccg
gcactgcgcactgtgcgcctggacgggaacccctggctgtgtgactgtgacttcgctcac
ctcttctcctggattcaggagaacacatccaaattgcccaaaggcctcgatgccatccag
tgttcactgcccatggaggaccggagggtggccctgagggagctatccgaagctagtttc
agcgagtgtaagttcagcctgtctctcacagacctattcatcatcatcttctctggggtg
gctgtgtccattgctgccatcatctccagcttcttcctggccactgtggtgcagtgtttc
cagaggtgcgcccctaacaaggacacggaagatgaggatgatgatgaagatgactga

DBGET integrated database retrieval system