KEGG   Mus musculus (house mouse): 242736
Entry
242736            CDS       T01002                                 
Symbol
Pramel12, 4732496O08Rik, Pramef8
Name
(RefSeq) PRAME like 12
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Casc1_N
Other DBs
NCBI-GeneID: 242736
NCBI-ProteinID: NP_001342653
MGI: 2140473
Ensembl: ENSMUSG00000046862
Position
4:143137457..143147661
AA seq 480 aa
MSVQDPPTLLQLSVQRLLRDEALAISSLQYLPRALFPLLFKEAFNHRQTNVLRAMVAVWP
FPFLPLGTLMKTPHLEILQAVLDGVDMLWTQKVLPRRRKLQVLDLRNVYHDFWDVWVGPE
DGDHSAETVCEKQIAKRLHQYALRRRLKVVTDLCLRFHLNEHQAYLLQWAQQRRSSIRLC
CVKMQIWALPVYTVRKVLMVFQPDSIQELELNTGWSLSTLVHFASYLDQMRNLQKLLLTR
IHKNTFKVLNTSSDIQKCITKFVSQFSKLNSLQHLSMNGIYFSSEHMKQLFRYLKTPLET
LSITMCKLSHLDLNSLSQSQSLHQLKQLNLRLVKLIDLRPVPFHDLLRSVAGTLQTLELE
GCWMVDSQLTALLPALSQCSQLTRVNFYDNDISMAVLKDLLYHTASLSQLTQELYPAPLE
CYDDTGDVLMGRFVQLCPELMETLITVRQPKNVSFATYICHECCQRCVYGLETKLCRCRQ
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagtgtccaggacccacccacactcctgcagctgtcagtacagagactactgagggac
gaggccctggccatttcttctctgcagtaccttcccagggcgcttttcccactgctcttc
aaggaagccttcaatcacagacaaactaatgtcctgagggccatggtggcagtgtggccc
tttcccttcctccctctggggaccctgatgaagactccccacctggagatcttgcaggct
gtgctggatggagtagacatgctttggacacagaaggttcttcccagaaggaggaagctc
caagtgctggacctgaggaatgtgtaccatgacttctgggatgtttgggttggaccagag
gatggagaccactcagcagagactgtgtgtgaaaagcagatagcaaagcgccttcatcaa
tatgcactgaggcgacgtttgaaggtggtcactgacctgtgcctcaggttccatttgaat
gaacaccaagcatacttgttacagtgggcccagcagagaagaagttccatacggctatgc
tgtgtgaagatgcagatttgggctttgcctgtgtacactgtcaggaaggtcttgatggtg
ttccagccagacagcatccaagaattggaactaaatacaggttggagcctgtccactctg
gtgcattttgcatcttacctggaccagatgagaaaccttcaaaaactccttttaacacgg
attcacaagaacaccttcaaggttctaaatacctcctcggacatccagaagtgtatcacc
aagtttgtctctcagttctccaaactcaactctctccagcatctctccatgaatggcatc
tacttttccagtgagcacatgaaacagttgttcaggtacctgaagaccccgttggagact
ctgtccatcaccatgtgcaagctttcacatttagacttgaattccttgtcccagagtcag
agcctccatcagctcaaacagctgaacctgagacttgtgaagttgattgacttacgtcct
gtgcctttccacgacctcctcaggagtgttgcaggcaccctgcagaccctagaactggag
ggctgttggatggtggactcccagctcactgccctcctgcctgccctgagccagtgttcc
cagctcaccagggtcaacttctatgacaatgacatctccatggctgttctaaaggacctt
ctgtatcacacagccagtctgagccagctgacccaggagctgtatcctgcccctctggag
tgctatgatgacacgggtgatgtccttatgggaagatttgtccaactttgtcctgagctt
atggagacactcattactgtaaggcagcccaagaatgtctcctttgctacgtatatctgc
catgaatgttgccagcgctgtgtctatggcctggagacaaaactttgtcgttgtcggcag
taa

DBGET integrated database retrieval system