KEGG   Mus musculus (mouse): 243277
Entry
243277            CDS       T01002                                 

Gene name
Adgrd1, E230012M21Rik, Gpr133
Definition
(RefSeq) adhesion G protein-coupled receptor D1
  KO
K08465  adhesion G-protein coupled receptor D1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    243277 (Adgrd1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    243277 (Adgrd1)
Peptidases and inhibitors [BR:mmu01002]
 Mixed peptidases
  Family P2
   243277 (Adgrd1)
G protein-coupled receptors [BR:mmu04030]
 Adhesion receptor family
  Others
   243277 (Adgrd1)
SSDB
Motif
Pfam: 7tm_2 Laminin_G_3 GPS Dicty_CAR Pentaxin
Other DBs
NCBI-GeneID: 243277
NCBI-ProteinID: NP_001074811
MGI: 3041203
Ensembl: ENSMUSG00000044017
Vega: OTTMUSG00000027719
UniProt: Q80T32
Position
5; 5 G1.3
AA seq 903 aa
MKDLPAFPCSWVWLLWSFCSVQVCSTQPRAQEHPGFAVLASASHYWPLENVDGILELQDT
TGALRTLNLTVPLSHNATFVFTNDSAYSNLSATVDIMEGKVNKGIYLKEEKGVTFLYYGT
YKSSCISNPAQCGPEGVTFSFFWKTQGDQTRPAPYAYGGQVVSDGFKVCSSGGKGSVELY
TRDNSMTWKATFNPPGPYWTHVLFTWKSKEGLKVYVNGTLSTSDPSGKVSHTYGDPHVNL
VIGSEQDQTKRYENGAFDEFIIWERALTPDEIKMYFTAAIGKHALLSSTPPAMPTAHTVI
PTDAYHPIITNLTEERKRFQRPGTVLRYLQNVSLRLPNKSLSEETALNLTETFLRTVGEV
LLLPSWTHESEDNAMTLGLVDTIDTVMGHISSNLQSREPHVTLTGSSSTAEFTVAKVLPP
ALSAPHYRFPAHGHSYIEIPREALHSQAWTTIVGLLYHTMHYYLKNIHPTSTEIPEAVNC
RDCLLSVASHLISLEVSPPPTLSQNLSGSPLITVHLRHKLTQKQYSDATNESNRLFLYCA
FLNFSSGEGVWSSQGCALTEGNLTYSVCHCTHLTNFAILMQVVPLKLTHGHQVALSSISY
VGCSLSVLCLAATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQVLLLISFSMEPGTVP
CQVLAVLLHYFFLTAFAWMLVEGLHLYSMVIKVFGSEDSKHLYYYGIGWGCPLLICIISI
SSSMDSYGTSDSCWLALGSGAIWAFVGPALLVIVVNIVILVAVTRVISHISTDSYKIHGD
PSAFKLTAKAVAVLLPILGTSWVFGVLAVSDRALVFQYMFAILNSLQGLFIFLFHCLLNS
EVRAAFKHKTKVWSLTSSSARTANTKPFSSDTVNGTRPGTASTKLSPWDKSSHSAHRVDL
SAV
NT seq 2712 nt   +upstreamnt  +downstreamnt
atgaaggatcttccagcattcccttgcagctgggtctggctactctggtccttttgcagc
gtccaggtgtgtagcactcagcccagagcccaggaacatccaggctttgcggtcttggct
tctgcttctcattactggccattggaaaatgtggatgggatccttgagcttcaggacaca
actggagcgctgcgaaccctcaacctcactgtgcctctctcccacaatgctacttttgtc
tttaccaatgactctgcctactccaacttgtctgcgactgtagatatcatggaagggaag
gtgaacaaaggcatttacctcaaggaggagaagggcgtgacgtttctctactatggcacc
tacaagtcatcctgtattagcaacccggcccagtgtggaccagagggagtgacattttca
ttcttctggaagactcaaggagaccagacccgaccagccccgtacgcatacgggggacag
gtcgtctctgacgggttcaaagtctgctctagtggtggaaagggctctgtggagctgtac
acacgtgataattccatgacgtggaaggccaccttcaaccctcccggtccttactggact
cacgtcctgttcacgtggaaatccaaggagggcctgaaggtctacgtcaatgggactctg
agcacctcggaccccagcgggaaagtgtcacacacctacggggatccccacgtcaacctg
gtcatagggtcagagcaggaccagaccaagcgttacgaaaacggagcttttgatgaattc
atcatctgggaacgggcactgactcctgacgagatcaagatgtactttaccgctgccatt
ggtaaacatgctctgttgtcttcaacaccaccagcgatgcccaccgcacacaccgtgata
cccacagatgcctaccaccctatcatcaccaacctgaccgaggagagaaaacgcttccag
agaccgggaactgtgctgagataccttcaaaatgtgtccctccgcttgcccaataaatcc
ctctcagaggaaacggcgctgaacctcacagagaccttcttaagaacggtgggtgaggtc
ctcctactgcccagctggacccatgaatcagaggacaacgccatgacgctgggcctggtt
gacaccatcgataccgtcatgggccacatatcatccaacctacagtccagagaaccccat
gtcaccctcacaggctcgtcctccacggcagaattcactgtggccaaggtcctcccacca
gcgctcagtgctccccactatagattcccagcccatgggcatagctacattgaaattccg
agagaggcccttcacagccaagcctggaccacgattgtcggccttctctaccacaccatg
cactattatctgaaaaacatccacccaaccagcacagagatccccgaggctgtgaactgc
agagactgcctgctgtctgtcgccagccacctgatctccctggaggtgtccccaccaccc
actctgtcccagaacctatccggctctcctctgatcactgtgcatctcagacacaaactg
actcaaaagcagtacagcgatgccaccaatgagagcaaccgtctcttcctgtattgcgcc
ttccttaacttcagctccggggaaggcgtctggtccagccagggctgtgcactcacagaa
ggaaatctcacttattcagtgtgccactgcacacacctcaccaacttcgccatcctcatg
caagtggtcccactgaagctcacacatggacaccaggtggcgctgtcgtccatcagttac
gttggctgctctctgtcagttctctgcctggctgccaccctggtcaccttcgcagtactg
tcttctgtcagcaccattcggaaccagcgttaccacatccacgccaacctgtccttcgct
gtcctggtagcccaggtcttgctgctgatcagcttcagcatggagcctggcacggtcccg
tgccaggtgctggctgtcctcctacattacttcttcctgaccgcctttgcttggatgctg
gtggagggactacatctctacagcatggtgataaaggtcttcggctcagaggacagcaag
cacctctactactatgggataggctgggggtgccctctcctcatctgcatcatctccata
tcatcctctatggacagctatgggacaagtgacagctgctggctggctctggggagtggc
gctatttgggcctttgtgggcccggctctgttggtcattgtggtcaacattgttatcctg
gttgctgtgacgagggtcatctcccacatcagcactgatagctacaagatacatggggac
cccagtgccttcaagttgacagccaaggctgtggctgtgctgctacccattctggggacc
tcatgggtatttggggtgcttgccgtcagtgaccgggccctggtcttccaatacatgttt
gctatactcaactctttacagggcctcttcatctttctctttcactgtctcctgaactca
gaggtaagggctgccttcaagcacaagaccaaggtctggtccctcacgagcagctctgcc
cggaccgcgaacacgaagcctttcagttcagacaccgtcaatgggacccgtccaggcacg
gcatctacaaagctaagcccttgggataagagcagccattctgcccaccgtgtcgaccta
tccgctgtgtga

DBGET integrated database retrieval system