KEGG   Mus musculus (house mouse): 243300
Entry
243300            CDS       T01002                                 
Symbol
Nyap1, 6430598A04Rik
Name
(RefSeq) neuronal tyrosine-phosphorylated phosphoinositide 3-kinase adaptor 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: NYAP_N NYAP_C
Other DBs
NCBI-GeneID: 243300
NCBI-ProteinID: NP_780730
MGI: 2443880
Ensembl: ENSMUSG00000045348
UniProt: Q6PFX7
Position
5:complement(137729144..137739430)
AA seq 833 aa
MNLLYRKTKLEWRQHKEEEAKRSSSKEAAPTGPVGPGAVPGPGVRVRDIASLRRSLRMGF
MTMPASQEHTPHPCRSTMAPRSLSCHSVGSMDSVGGGPGGGLTEDSSTRRPPAKPRRHPS
TKLSMAGPGAETPPSKKAGSQKPAPECRESSRKVPPQKPRRSPNTQLSVSFDESCAPAPS
PRGANLPLQRLSRASRITGDLDAGAQEEEPVYIEMVGDVFRGGGRSGGGLAGPPLGSGGP
TPPAAADSDSEDSEAIYEEMKYPLPEEAGDGRANGPPPLTAPSPPQQTHILQPHPHPHRR
PASALPSRRDGTPTKTTPCEIPPPFPNLLQHRPPLLAFPQAKSASRAPGDGVSRLPVLCH
SKEPAGSTPAPQVPARERETPPLPPPPPAANLLLLGPSGRARSHSTPLPPQGSGQTRGER
ELPNSHSMICPKAAGVPAAHPAPAALLPGPPKDKAVSYTMVYSAVKVTTHSVLPAGPPLG
VGEPKTEEISVLHGMLCASSRPPVPGKSSPHSGAMGSAAGVLHHRSCLASPHSLPDPTGG
SLTPLWTYPATAAGLKRPPAYDSLKAGGVLNKGCGMGAPSPMVKIQLQEQGTDGGAFASI
SCAHVIASAGTPEEEEEMGAAFGAGWALQRKVLYGGRKAKEVDTEEDGARAWNGSTEGPG
KVEHEDRGPVPSGIPVRSQGAEGLLARIHHDRGGSRTALPVPCQTFPACHRNGDFTGGYR
LGRSASTSGVRQAALHTPRPCSQPRDALSQTHPVLPLPLPPQPARERDGKLLEVIERKRC
VCKEIKARHRPDRGLCKQESMPILPSWRRVPEPRKSGTPPCRRQHTVLWDTAI
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgaaccttctctaccgaaaaaccaagctggagtggagacagcacaaagaagaggaggcc
aaacggagctccagtaaggaagcagcccccacaggcccggtggggcctggggctgtccca
gggcctggggttcgagtgcgagacattgcctcgcttcgacgatccctcaggatgggtttc
atgacgatgcccgcgtcccaggaacacacccctcacccctgccgcagcaccatggcccca
cgctctctctcctgccactcggtgggcagcatggacagtgtaggtggtgggcctggggga
gggctcacggaggacagcagcacccggagacccccagctaagccccggagacaccccagc
accaagctcagcatggcaggaccaggggcagagacacctccaagtaagaaagcaggctcc
cagaagccagctcccgaatgccgtgagtccagccggaaggttcccccacagaaacccagg
cgaagccccaatacccagctgtctgtgtcctttgatgagtcttgtgccccagccccatct
cctcgaggggcgaacctgcccctgcaacgcctcagtagggcttctcgaataactggagac
ctggatgcaggggcccaggaagaagagccagtgtacattgagatggtaggggatgtcttt
cgaggaggaggacgaagtggaggaggcctggcgggacctcctcttggaagtggaggccca
acccctccagctgctgccgattcggactctgaagacagtgaggctatctatgaagagatg
aagtaccccttgcctgaagaagcaggagatggcagggccaacgggcctcctccattgacg
gcaccctcccctccacaacagacccatatcctccagcctcacccccacccccatcgccgt
ccagcttcagccctcccaagccggagggatgggacacccaccaagaccacaccttgtgaa
ataccgccaccctttcctaacctccttcagcaccggcctccacttctggccttccctcaa
gccaagtctgcttcacgagcccctggtgatggggtctcaaggctaccggtcctctgccac
tccaaggagccagctggttccaccccagctccccaagtgcctgcacgagagcgggagacg
cctcccctaccacctccgcctcctgctgccaacctgctattgctgggaccatcaggccga
gcccggagccactcgacaccgttgccaccccagggctctggccagaccaggggagagcgg
gaactcccgaactctcacagcatgatctgccccaaggcggcaggggtacccgcagcccac
cctgccccagctgccttgctccccggccctcccaaggacaaggccgtgtcgtacactatg
gtgtattctgcggtaaaagtgaccacacactcggtcctgccagctggtccacccctgggt
gttggagagccaaagacagaggagatttcagtacttcatggaatgctgtgtgccagttcg
aggccccctgtcccagggaaatccagcccccatagcggggctatgggttcagcagctggg
gtcctccaccaccgcagctgcctggcctccccccacagccttccggatccaactggaggt
tccctgactcccctctggacctacccagccacagcagctgggctcaagagaccccctgcc
tatgacagcctcaaggctgggggggtgttgaataagggctgtggaatgggggcaccatcc
cccatggtcaagatccagctgcaagagcaagggactgatgggggtgcctttgccagcatc
tcctgtgcccatgtcattgccagtgcggggacgccagaagaggaagaagagatgggggcc
gcgtttggggcaggctgggctctgcagaggaaggtcctgtatggaggacggaaggcaaag
gaagtggacacagaagaggacggtgcccgagcctggaatggcagtacagaaggtccaggc
aaagtcgaacatgaggacaggggccctgtgccatcagggattcctgtgaggagccagggg
gcagagggtctgctggccaggatccaccatgatcgaggagggagccgcacagcgctgcct
gtcccttgccagactttccctgcctgccaccggaatggagatttcacgggagggtaccgc
ctgggccgttctgcgtccacctctggagtccgtcaggctgcactccataccccacggccc
tgcagccagcccagggatgccctgagccagacacaccctgtgctgcccctgcccctgccg
ccccagccggctcgggagcgcgatggcaaactcctagaggtgatcgagcgcaaacgctgc
gtgtgcaaggagatcaaggcacgccaccgtcccgaccgggggctctgcaagcaagagagc
atgcccatcctccccagctggcggcgggtccctgaaccccgcaagtctggtaccccgccc
tgccggcggcagcacacggtcctctgggacactgccatctga

DBGET integrated database retrieval system