KEGG   Mus musculus (house mouse): 243328
Entry
243328            CDS       T01002                                 
Symbol
Slc29a4, ENT4, mPMAT
Name
(RefSeq) solute carrier family 29 (nucleoside transporters), member 4
  KO
K03323  solute carrier family 29 (equilibrative nucleoside transporter), member 4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    243328 (Slc29a4)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   243328 (Slc29a4)
SSDB
Motif
Pfam: Nucleoside_tran
Other DBs
NCBI-GeneID: 243328
NCBI-ProteinID: NP_666369
MGI: 2385330
Ensembl: ENSMUSG00000050822
UniProt: Q8R139
Position
5:142678124..142708245
AA seq 528 aa
MGSIGSQRLKEPCVAATSDQSVVTSFSFDNFQLETTAEGAQDPGIRVRGVPTFTDSAVEE
PVPDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAV
LLNNVVVERLNLHTRITTGYLLALGPLLFISICDVWLQLFSHDQAYAINLAAVGTVAFGC
TVQQSSFYGYTGLLPKRYTQGVMTGESTAGVMISLSRILTKLLLPDERASTIIFFLVSAG
LELLCFLLHLLVRRSRFVLYYTTRPRDSRPVQAGYRVHHDVASGDIHFEHQTPALSSSRS
PKESPAHEVTHSNSGVYMRFDVPRPRVKRSWPTFRALLLHRYVVARVIWADMLSIAVTYF
ITLCLFPGLESEIRHCVLGEWLPILVMAVFNLSDFVGKILAALPVEWRGTHLLACSCLRV
VFIPLFILCVYPSGMPALRHPAWPCVFSLLMGISNGYFGSVPMILAAGKVSPKQRELAGN
TMTVSYMSGLTLGSAVAYCTYSLTRDAHGSCFQTATAAAANDSIPVGP
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgggctctatcggaagccagcgcctcaaggagccctgcgtggcagccacatctgaccag
agtgtggtgacaagctttagctttgacaacttccagctggagacgacagcagagggggct
caggatccaggcatcagagtcaggggtgtccccactttcacagactctgcggtagaggag
cctgtgccagatgaccgctaccatgccatctactttgccatgctgctggctggcgtgggc
ttcctactgccatacaacagctttatcaccgatgtcgactatcttcaccacaagtaccca
gggacctccatcgtatttgacatgagcctcacctatatcctggtggcattggcggctgtg
ctcctaaacaacgttgtggtggagaggttgaacctgcacaccaggatcaccacaggctac
ctcctcgccttgggtcccttgctctttatcagcatatgcgatgtgtggctgcagctcttc
tctcacgaccaggcttacgccatcaacctggccgccgtgggcactgtggcctttggttgc
acagtgcagcaatctagcttctatggctacacgggattactgcccaagaggtacacgcag
ggtgtgatgactggagagagcacggcaggggtgatgatctctctgagtcgaatcctcact
aagctgctgctcccggacgagcgggccagcaccatcatcttcttcctggtgtctgccggc
ttggagctcctgtgcttcctgctgcatctgctggtgcggcgcagccgttttgtgctctac
tataccactcggccccgtgacagccgccccgtccaggcaggctaccgagtgcaccacgat
gtcgcatccggagacatccactttgagcaccaaactccagccctatccagcagcaggtcc
ccgaaggagagcccggcccatgaggtgacgcacagcaacagtggggtctacatgcgtttt
gatgtgccccggccacgagtcaaacgaagctggcccaccttcagagccctgctgttgcac
cgatacgtcgtggcgcgggtcatctgggccgacatgctgtccattgcggtaacctacttc
attacactgtgcctgtttccgggcctggagtccgagatccgccactgcgtgctgggggag
tggctgcccatcctggtgatggccgtgttcaacctgtcagactttgtgggcaagatcctg
gcagccctgcccgtggagtggcggggcactcacctgctcgcctgctcttgcctgcgtgtg
gtcttcatccccctcttcatcctgtgtgtgtaccccagtggcatgcctgccctccgccac
cctgcctggccctgtgtcttctcgctgctaatgggcatcagcaatggctactttggcagt
gtgcccatgatcctggcagctggaaaagtgagccccaagcagcgggaactggcaggaaac
accatgactgtgtcctacatgtcggggctgaccctgggctctgctgtggcctactgcacc
tacagcctcacccgagatgcccacggcagctgctttcaaacagccaccgccgccgccgcc
aacgactccatccctgtcggtccctga

DBGET integrated database retrieval system