KEGG   Mus musculus (mouse): 243362
Entry
243362            CDS       T01002                                 

Gene name
Stard13, DLC2, GT650
Definition
(RefSeq) StAR-related lipid transfer (START) domain containing 13
  KO
K20632  deleted in liver cancer protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    243362 (Stard13)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    243362 (Stard13)
SSDB
Motif
Pfam: START RhoGAP SAM_2 ALIX_LYPXL_bnd
Other DBs
NCBI-GeneID: 243362
NCBI-ProteinID: NP_666370
MGI: 2385331
Ensembl: ENSMUSG00000016128
Vega: OTTMUSG00000023438
UniProt: Q923Q2 Q3UWP1
Position
5; 5 G3
AA seq 1113 aa
MFSQVPRTPAAGCYYLNPLTPESQEMYLRFDQTARRSPYRMSRILARHHLVTKIQQEIEA
KEACDWLRAAGFPQYAQLYEDSQFPINIAAVKKDHDFLERDLVEPLCRRLNTLNKCASMR
LDVNFQRKKGDDSDEEDLCISNKWTFQRTSRRWSRVDDLHTLFPVADRNGSPGGPRMRNT
ASSESVLTDLSEPEVCSIHSESSGGSDSRSQSGHHSADSTHALEATLVSSSLPQSTREGL
NQSFHPKNEKPTRTRAKSFLKRMDTLRVKGALGRHKGPGRTGGLVISRPVLQQEPESFKT
MQCVQIPNGDLQTSPPAACRKGLPCSSKSSGESSPLENSSTVSTPCMKERKCHHEANKRG
GMYLEDLDVLAGTALPDTSDQNHMHGFHSQENLVVHIPKDHKPGTFPKALSIESLSPTDN
SNGVNWRTGSISLGRQQGPGMREPRLMSSCHRASRVSIYDNVPSSHLYASTGDLLDLEKD
GLLPQLDDILQHVNGIQEVVDDWSKNILPELQSHSTLAGDPGLSPFPSPNQVTLDFEGNS
VSEGRTTPSDVERDRTSLNESEATGVRERRDSGVGASLTRPNRRLRWSSFQLSHQPQPSP
ATPHISSQTAAQLNLLQRFSLLRLTAIMEKYSMSNKHGWTWSVPKFMKRIKAPDYRDKAV
FGVPLIVHVQRTGQPLPQSIQQALRYLRSNCLDQVGLFRKSGVKSRIHALRQMNENFPDN
VSYEDQSAYDVADMVKQFFRDLPEPLFTNKLSETFLHIYQYVPKEQRLQAVQAAILLLAD
ENREALQTLLCFLHDVVNLVDENQMTPMNLAVCLAPSLFHLNLLKKESSPKVIQKKYATG
KPDQKDLNENLAAAQGLAHMITECNRLFEVPHEMVAQSRDSYLEAEIHVPSLEDLGAQLA
ESGATFHTYLEHLVQGLQKEAKEKFKGWVTCSSPDNTDLAFKKVGDGHPLKLWKASVEVE
APPSVVLNRVLRERHLWDEDFVQWKVVERLDKQTEIYQYVLNSMVPHPSRDFLVLRTWKT
DLPKGMCTLVSLSVEYEEAQLMGGVRAVVMDSQYLIEPCGSGKSRLTHICRIDLKGHSPE
WYSKGFGHLCAAEVTRIRNSFQPLVAEGPETKI
NT seq 3342 nt   +upstreamnt  +downstreamnt
atgttcagccaggtgcccaggacgccggctgcaggctgctactatctaaaccccttgaca
cctgagagccaggagatgtacttgcgatttgatcagactgccagacgctctccctacagg
atgagccggatcctagcacgccatcacctagtgactaaaatccagcaagaaattgaggcg
aaggaagcatgtgactggctccgagctgccgggttcccgcagtacgctcagctgtatgaa
gattcgcagttccccatcaacattgcggccgtcaaaaaagaccatgactttcttgaaagg
gaccttgtagaacctctttgcagacgacttaatacgttgaacaagtgtgcctcaatgaga
cttgatgtgaacttccaaaggaaaaagggtgacgactcagatgaggaagacctgtgcatc
agcaacaaatggactttccagagaaccagccgcagatggtcccgtgtggatgacctgcat
acgctgttccccgtggcagacagaaacgggtccccaggaggccctaggatgagaaacaca
gccagcagtgagagcgtgctcacggatctgagtgagccagaggtctgctctattcacagc
gaaagcagtgggggcagtgacagccgcagccaatcagggcatcattctgctgacagtacg
catgcgctggaggccaccctggtcagtagcagcctcccacagtctacccgagagggtctc
aaccagtcttttcaccccaagaatgagaaacccaccaggaccagggccaagtcctttctg
aaacgcatggataccctgagagtgaagggtgcacttgggaggcataaggggccagggcgg
acaggaggcctggtcatcagtaggcctgtgctgcagcaggaaccggagtcctttaagacc
atgcagtgcgtccagatacccaacggagatctgcagacctcacctccagctgcctgcagg
aaaggcctcccatgctccagtaagtcaagtggtgagagcagccccctggagaacagcagc
acagtgagcactccgtgcatgaaggaacgcaagtgccaccacgaggccaacaagcgcggt
ggcatgtacctggaggacctggatgtgctggcagggacggcattaccagatacgtcagac
caaaaccacatgcatgggtttcactcccaagaaaacttggtggtccacattcccaaggat
cacaaaccaggaacgttccccaaggcactttctatagaaagcctctcacccacagacaac
agcaatggggttaactggaggaccgggagtatctccctgggtaggcaacagggccctggc
atgagggaacccagactcatgtcttcctgccacagggccagccgtgtcagtatctatgac
aatgtccccagctcgcacctgtatgccagcacaggagatctgttggacctggagaaagac
ggcctccttccacagctggatgacatcctacagcatgtcaatggcatacaagaggtagtg
gatgactggtcaaaaaacatcttacccgaactgcaaagtcacagcacattggcaggggat
cctggtctgtccccattcccatctcccaatcaggtcactttagattttgaaggcaactct
gtctcagaaggtcggacaacacctagtgatgtggaaagggacaggacttctctgaatgaa
tcggaggccactggggtcagagaaagaagggattctggtgtgggggcctctctgaccaga
ccaaacagacgactaaggtggagcagcttccagctctcacaccagccccagccgtctcca
gccaccccgcacatcagcagccagacggccgcccagctgaacctgctccagcgcttctcc
ctacttcgtcttacggccatcatggagaagtactctatgtccaacaagcacggctggacc
tggtccgttccaaagttcatgaagaggatcaaagctcctgactaccgagacaaggctgtc
ttcggtgttccgctcatagtccacgttcagagaacaggacagcccctgcctcagagcatc
caacaagcactgaggtatctacgtagcaactgtctggatcaggtgggtcttttccgcaag
tcaggagtgaagtctcgaatccatgccctccgtcagatgaatgagaacttccctgacaat
gtgagctatgaagaccagtctgcatacgacgtggcagatatggtgaagcagttcttccgg
gacctccctgagcccctgttcaccaacaagctcagcgagaccttcctccacatctatcag
tatgtccccaaagagcagcggctgcaggccgtgcaggcagccatcctgctgctggccgac
gagaaccgggaggccctgcagactctcctgtgcttcctgcatgacgtagtaaacttggtg
gacgagaatcagatgacgcccatgaatctggccgtgtgcctggccccctccctctttcac
ctaaacttactgaagaaagaaagctccccaaaagtcatccagaagaaatacgccactggg
aagccagatcagaaggacctcaatgaaaatctagctgcggctcaggggctggcccacatg
atcacggaatgcaaccgactctttgaggttccacacgagatggtggcccagtctcgggac
tcctacttagaggctgaaatccatgtgcccagcctggaagacttgggagcacagctggcg
gagagcggggcaacttttcacacgtacttggagcatctagtccaaggcctccagaaagag
gctaaggagaaattcaagggatgggtcacatgttccagccctgacaacacagaccttgct
ttcaaaaaggtgggcgatgggcacccgctgaagctgtggaaagcatctgtggaggtggag
gcaccaccctccgtggtgctgaaccgtgtgctgagagaacgtcacctgtgggatgaggac
tttgtgcagtggaaggtggtggaaagattggacaaacaaacggaaatctaccagtacgtg
ctaaacagcatggttccacatccctccagagacttcctggtgctcaggacctggaagact
gacctgcccaaaggaatgtgcaccctggtgtccctgtctgtggagtacgaagaagcccag
ctcatgggtggcgtgagggcggtggtgatggactctcagtacctgatagaaccctgcggt
tctggcaagtccaggctgacccacatctgcagaatagacctgaagggccactccccagaa
tggtacagcaaaggctttggacacctctgtgcggcagaagttaccagaattaggaactct
ttccagcctctcgttgctgagggtccagaaacaaaaatctaa

DBGET integrated database retrieval system