KEGG   Mus musculus (mouse): 243369
Entry
243369            CDS       T01002                                 

Symbol
Sspo, C79529, Scospondin
Name
(RefSeq) SCO-spondin
  KO
K24434  SCO-spondin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    243369 (Sspo)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Thrombospondin domain-containing proteins
  Other thrombospondin domain-containing proteins
   243369 (Sspo)
SSDB
Motif
Pfam: TSP_1 TSP1_spondin VWD TIL C8 Ldl_recept_a F5_F8_type_C TSP1_ADAMTS Pacifastin_I VWC TSP1_CCN
Other DBs
NCBI-GeneID: 243369
NCBI-ProteinID: NP_775604
MGI: 2674311
Ensembl: ENSMUSG00000029797
Vega: OTTMUSG00000045396
UniProt: E9Q0I4
Position
6; 6 B2.3
AA seq 5144 aa
MLPLALLFGMLWTQANGHWCEQIETVHVEEEVTPRQEDLVPCTSLYHYSRLGWQLDLSWS
GRVGLTRPPALGLCAIYKPPETRPATWNRTVRACCPGWGGAHCTDALAETSPKGHCFVTW
HCQPLAGSANSSAGSLEECCAQPWGHSWWNSSSQMCLSCSGQHRPGNASSEGLLQPLAGA
VGQLWSQRQRPSATCATWSGFHYQTFDGHHYHFLGQCTYLLAGAMDSTWAVHLRPSVHCP
QHRHCWLVQVVMGPEEVLIQDGEVSVKGQPVPVGEPQLLHGMSLQWQGDWLVLSGGLGVV
VRLDRSSSISISVDHEFWGRTQGLCGLYNGRPEDDFVEPGGGLATLAATFGNSWKLPGSE
PGCLDAVEVAWGCESLLGGTLTDLEAVKLQAQAQDMCHQLLEGPFWQCHGQVQPDEYHET
CLFAYCVGATAGNGPEGQLEAVCATFANYAQACARQHIYVHWRKPGFCERVCPGGQLYSD
CVSSCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGALCVPAAHCPCYHRRQRYAPGD
TVKQQCNPCVCQDGRWHCAQALCPAECAVGGDGHYFTFDGRSFFFRGTPGCHYSLVQDSV
KGQLLVVLEHGACDTGSCLHALSVFLGNTHIQLRYSGAVLVDGEDVDLPWIGVEGFNISW
ASSTFLLLHWPGAWVLWGVAEPAAYITLDPRHAYQVQGLCGTFTWKQQDDFLTPAGDIET
SVTAFASKFQVSGDGRCPLVDKSPLFCSSYSQHLTFTEAACAILHGHAFQECHGLVDREP
FRLRCLEAVCGCAPGRDCLCPVLSAYTRHCAQEGVLLQWRNETLCPVSCPGGQVYQECAP
VCGHHCGEPEDCKELGICVAGCNCPPGLLWDLEGQCVPPSMCHCQFGGHRYTINTTTVRD
CSHCICQERGLWNCTAHHCPRQWALCPRELIYVPGACLLTCDSPRANHSCWAGSTDGCVC
PPGTVLLDKHCVSPDLCPCRHNGQWYPPNATIQEDCNICVCQGQRWHCTGQRCSGWCQAS
GAPHYVTFDGLVFTFPGACEYLLVREAGGRFSVSVQNLPCGASGLTCTKALVVRLDSTVV
HMLRGQAVTVNGVSIRLPKVYTGPGLSLHHAGLFLLLTTRLGLTLLWDGGTRVLVQLSPH
FHGRVAGLCGNFDSDASNDLRSRQGVLEPTAELTAHSWRLNPLCPEPGDLPHPCTVNAHR
ANWARARCEVILQPIFAPCHTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIATYADECA
RHRHHVRWRSQELCPLQCEGGQVYEPCGSTCPPTCHDHHSELRWHCQVITCVEGCFCPEG
TLLHGGACMKLAACPCEWQGSFFPPGTVLQKDCGNCTCQGSQWHCDRGGAPCEDMEPGCA
EGETLCRENGHCVPLEWLCDNQDDCGDGSDEEGCATSVCGEGQMSCQSGHCLPLSLICDG
QDDCGDGTDEQGCLCPHGSLACADGRCLPPALLCNGHPDCLDAADEESCLGPVSCISGEV
SCVDGTCVRTIQLCDGVWDCPDGADEGPSHCSLPSLPTPPGGIGQNPSTSSLDTAPSPVG
STSPASPCSLLEFQCNSGECTPRGWRCDQEEDCTDGSDELDCGGPCMLYQVPCAHSPHCV
SPGQLCDGVTQCPDGSDEDPDVCEEQSASGGANRTGAPCPEFSCPDGTCIDFLLVCDGNP
DCELADETEPSLDEQGCGAWGSWGPWAPCSQTCGSGTRSRNRNCSTSSLQVLQNCPGLQH
QSQACFTEACPVDGEWSSWSPWSPCSEPCGGTTTRHRQCRPPQNGGQDCALLPGSTHSTR
QTSPCPQEGCLNATCFGELVFRTCAPCPLTCDDISGQAACPPDRPCSSPGCWCPDGKVLN
TEGQCVRPRQCPCLVDGAHYWPGQRIKMDCQLCFCQDGQPHRCRPNPECAVDCGWSSWSP
WAECLGPCSSQSLQWSFRSPNNPRLSGHGRQCRGIHRKARRCQTEACEGCEQWGLMYNVG
ERWRGGPCMVCECLHSSITHCSPYCPIGSCPQGWVLVEGMGESCCHCALPEKNQTVIHMT
TPAPAPASAPSPQIGAHLVTYVLPPTADACYSPLGLAGLPMWAPSQHWEHITRADPVEAP
MAGPGPREGASAEWHTQPLYLQLDLRRPRNLTGIIVQRAGSSAAYVSTLSLQFSSDNLQW
HNYVNSLSSTLSPPKPSPESSNHMAPEVWTFDQMVQARYIRVWPHSGHLRDNNQHDIFLW
VELLGLSPLAPLCPGSRHRCASGECAPKGGPCDGAVDCDDGSDEEGCGSLHASTTSRVHP
MTRTPALSPTQPGKFPREGLPDTEPQQPKQESSLPGAGVSGLIPASEGTLPVSGQPMQTL
SATSTFPPGAKSLHPGMAAVTVHPPHSVTPGAPVGQTVSPRPFPPMPCGPGQVPCDVLGC
VEQEQLCDGREDCLDGSDEQHCASAEPFTVPTTALPGLPASKALCSPSQLRCGSGECLPF
EHRCDLQVNCQDGSDEDNCVDCVLAPWSGWSDCSRSCGLGLIFQHRELLRLPLPGGSCLL
DQFRSQSCFVQACPVAGAWAEWGPWTACSVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSH
EKAPCNLQLCPGDTDCEPGLVHVNAELCQKGLVPPCPPSCLDPEANRSCSGHCMEGCRCP
PGLLLQDSHCLPLSECPCLVGQKLIQPRLAFLLDNCSQCICEKGTLLCKPGACSQSCGWS
AWSPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACYTDCGTEIPGWTPWT
SWSSCSQSCLVPGGDPGWRQRSRLCPSSRDTFCPGEATQEEPCSPPVCPVPSAWGLWASW
STCSASCNGGIQTRGRSCSGSAPGNPVCLGPHTQTRDCNMHPCTAQCPGNMVFRSAEQCL
EEGGPCPQLCLAQDPGVECTGSCAPSCNCPPGLFLHNASCLPRSQCPCQLHGQLYAPGAV
AHLDCNNCTCISGEMVCTSKRCPVACGWSPWTPWSPCSQSCNVGIRRRFRAGTEPPAAFG
GAECQGPNLDAEFCSLRPCRGPGAAWSSWTPCSVPCGGGYRNRTQGSGPHSPIEFSTCSL
QPCAGPVPGVCPEDQQWLDCAQGPASCAHLSIPGEANQTCHPGCYCLSGMLLLNNVCVPV
QDCPCAHRGRLYSPGSAVHLPCENCSCISGLITNCSSWPCEEGQPAWSSWTPWSVCSASC
NPARRHRHRFCARPPHRAPFSLVLLTTVAAPTTLCPGPEAEEEPCLLPGCNQAGGWSPWS
PWSGCSRSCGGGLRSRTRACDQPSPQGLGDFCEGPQAQGEACQAQPCPVTNCSAMEGAEY
SPCGPPCPRSCDDLVHCVWRCQPGCYCPLGKVLSADGAICVKPSYCSCLDLLTGKRHHAG
TQLMRPDGCNHCTCMEGRLNCTDLPCQVSGDWCPWSKWTACSQPCRGQTRTRSRACVCPA
PQHGGSPCPEESGGTGVQHQMEACPNATACPVDGAWSPWGPWSSCDACLGQSYRSRVCSH
PPISDGGKPCLGGYQQSRPCRNSSTLCTDCGGGQDLLPCGQPCPHSCQDLSLGSTCQPGS
AGCQSGCGCPPGQLSQDGLCVFPVDCHCHFQPRAMGIPENRSRSVGSTLSSWESLEPGEV
VTGPCDNCTCVAGILQCHEVPSCPGPGIWSSWGPWEKCSVSCGGGEQLRSRQCARPPCPG
LAQQSRICHIHVCRGCPAGRLYRECQPSDGCPFSCAHVTGQVACFSERCKEGCHCPEGTF
QHHVACVQECPCVLTVLLLQELGLASAALGSYPTLLGDEGKPLGPGVELLPGQMLQTDCG
NCSCVHGKLSCSMVECSRVHGSFGPWGMWSLCSRSCGGLGTRTRTRQCVLPTLAPGGLSC
RGPLQDLEYCFSPECPGTAGSTVEPVTGLAGGWGPWSPWSPCSHSCTDPAHPAWRSRTRL
CLANCTVGDSSQERPCNLPSCAALLPCPGPGCGSGNCFWTSWAPWEPCSRSCGVGQQRRL
RAYHPPGPGGHWCPDILTAYQERRFCNLRACPVPGGWSHWSPWSWCDRSCGGGRSLRSRS
CSSPPPKNGGTSCVGERHHVRPCNPMPCEEGCPAGMEMVSCANHCPYSCSDLQEGGMCQE
DQACQLGCRCSEGFLEQDGGCVPVGHCECTDAQGRSWAPGSQHQDACNNCSCQAGQLSCT
AQLCSPPAHCAWSHWSAWSSCSHSCGPQGQQSRFRSSTSGSWALECQKEQSQSQPCPEVP
CPPLCLHEAHLHELGDNWLHGECQQCSCTPEGAICKDTDCAVPRGWTLWSSWSYCSVSCG
GGSQVRTRSCTVSAPPHGSLSCEGPDTQTRHCGQQLCLQKLERCSWGPWGPCSRSCGTGL
ASRSGSCPCLLTKEDSKCNDTFLGLDTQACYSGPCQDDCTWGDWSSWTRCSCKVLVQQRY
RHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLNHR
LCQDLPPCQPGCYCPKGLLEQAGSCILPEQCNCWHISGEGARVTLAPGDRLQLGCKECVC
RRGELQCSSQGCEGLLPLTGWSEWSPCGPCLPQSALAPASRTALEGHWPLNTSDLPPPSV
TLLASEQYRHRLCLDPETRRPWAGDPALCTVPLSQQRLCPDPGACNDTCQWGPWGPWSPC
QMPCSGGFKLRWRVARDTSAGECPGPWAQTESCNMGSCPGESCETRDTVFTLDCANQCPR
SCADLWDGVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRCGLPSANASWELAPTQVVQL
DCHNCTCINGTLMCPHLECPVLGPWSAWSECSAVCGKGTMVRHRSCEEHPDREPCQALDL
QQWQECNLQACPECPPGQVLSTCATMCPSLCSHLWPGTICVREPCQLGCGCPGGQLLYNG
TCIPPEACPCTQFSLPWGLTLPLEEQARELPSGTVLTRNCTHCTCQGGAFICSLTDCQEC
APGEIWQHGKLGPCEKTCPEMNMTQAWSNCTEAQAPGCVCQLGYFRSQTGLCVPEDHCEC
WHHGSPHLPGSEWQEACESCRCLHGKSVCIRHCPELSCAQGEVIMQEPGSCCPICQQDTL
STEEEEPVSCRYLTELRNLTKGPCHLDQIEVSYCSGHCRSSTNVMTEEPYLQSQCDCCSY
RLDPDSPVRILNLLCPDGHTEPVVLPVIHSCQCSACQGGDFSKH
NT seq 15435 nt   +upstreamnt  +downstreamnt
atgctgcctcttgcccttctctttgggatgctatggactcaggctaatgggcattggtgt
gagcagatagagactgtccatgtggaagaggaagtaacgcctcgtcaggaggacctcgta
ccctgcaccagtttgtaccattatagccgcctaggctggcagctggacctgtcctggagt
ggccgtgtggggctcaccaggcccccagcacttgggctctgtgcgatctacaaacccccg
gaaaccaggcctgctacttggaaccggacagtgagggcttgttgtccaggatggggggga
gctcactgtaccgatgcccttgctgaaaccagccctaaaggtcattgctttgtcacatgg
cattgccaacctctagcaggctcagctaactcttcggcaggaagcctagaggaatgctgt
gcccaaccctggggacacagctggtggaacagcagctcccagatgtgcctcagctgttct
ggtcagcaccgcccaggcaatgcttcctctgaaggcctcctgcagcctctggcaggagct
gtaggccagctctggagccagcgccagcgtccctcagccacctgtgccacctggtctggc
ttccactaccaaacttttgacggacatcactaccacttcctgggccagtgtacctacttg
ctagctggtgctatggattccacctgggctgtccacctcaggcctagtgtccactgtccc
cagcatagacactgctggctggttcaagtggtgatgggccctgaggaggtattgatccaa
gatggagaggtctctgtgaagggccagccagtgcctgttggggagcctcagctgctccat
gggatgagcctgcagtggcagggagattggctggtgctctctgggggcctgggggtggtt
gtgagactggacaggtccagttccatctccatctccgtggaccatgagttctggggacgg
acacagggcctctgtgggctttacaatggcaggccagaggatgactttgtggagccggga
gggggattggctacgctagctgctacctttgggaattcatggaagctccctggctctgag
cctgggtgtctggatgcggtggaagtggcttggggctgtgagagcctcctaggaggtaca
ttaactgacttggaagctgtcaagcttcaagctcaagctcaggacatgtgccaccaactg
ctggagggtccattctggcaatgtcatggacaggttcagccagatgagtaccatgagacc
tgtctctttgcctactgtgttggagccacagcaggcaatggcccagaggggcaactggag
gctgtgtgtgccacctttgccaactatgcccaggcctgtgccaggcagcacatctatgtg
cactggaggaagcctggcttctgtgaacgtgtgtgtccaggggggcagctctactctgat
tgtgtctcatcctgtccacccagctgttcagcagtagcccagggagaggaggggtcttgt
gggaaagagtgtgtgagtggctgtgagtgcccaacaggcctcttctgggatggtgccctc
tgtgtgcctgctgcccactgcccctgctaccaccggcgccagcgctacgctcctggtgac
accgtgaaacagcagtgcaatccttgtgtttgccaggatggtcgctggcactgtgcccag
gccctgtgccctgctgagtgtgcagtgggtggtgatggacattacttcacctttgatggg
cggagcttcttcttcaggggcactcccggctgccactacagcctggtgcaggactctgtg
aaaggccagctgctggttgtgttggaacatggggcctgtgacactgggagctgcctccat
gccctctctgtcttcctggggaacacccacattcagctcagatactcaggagctgtgctg
gtagacggggaggatgtagacctgccctggattggtgttgagggcttcaatatttcctgg
gcctcttctacattcttgctattgcactggcctggggcctgggttctctggggagtggct
gagcctgcggcatacatcacgctggacccccgtcatgcctaccaggtgcagggtctgtgt
ggtacttttacctggaagcaacaggatgactttctgacaccggctggagacatagagact
agtgtcactgcctttgctagcaagttccaagtgtcaggtgatggaaggtgccccttggtg
gacaaaagcccactcttctgcagttcttactctcagcacctcaccttcacagaggcagcc
tgtgccatcctgcatggccatgccttccaggagtgtcatgggttagtagacagggaacca
tttcgattacggtgcttggaggccgtgtgtggctgtgcccctggcagggactgcctgtgc
cctgtgctctctgcctatacacgtcactgtgcccaggagggcgtcctgctgcaatggagg
aatgagaccctgtgccctgtttcgtgtcctggtggccaggtgtaccaggagtgtgcccca
gtgtgtggtcaccattgtggggagccagaggactgtaaagagctgggcatctgtgtggct
ggttgtaattgtcccccgggactactgtgggaccttgaaggccagtgtgtgcctcccagc
atgtgccactgtcaatttggaggccatcggtacaccattaacaccaccactgtgagagac
tgcagccactgcatctgccaggagaggggcctctggaactgcacagcccaccactgcccc
cgacagtgggctctctgccctcgggagctcatctatgtccctggtgcctgccttctcacc
tgtgacagcccccgtgccaaccattcctgttgggctggaagcactgatggctgtgtctgt
ccccctggcactgtattgctggacaagcactgtgtgtctcctgatctttgtccctgtcgc
cacaacgggcaatggtacccacccaatgccaccatccaggaagactgcaacatttgtgtg
tgccagggccagcgctggcactgtacaggtcagcggtgcagtggatggtgccaggcgtcc
ggcgcaccccactatgtgacgttcgatgggctggtctttacctttcctggggcctgcgag
tacctgctggtgagagaggctggtggccgcttcagtgtctccgtccagaacttgccttgt
ggggccagtggcctcacatgtaccaaggcgttggttgtgcgtctggacagcactgttgtg
cacatgctgagaggccaggccgtaacagtgaatggagtgagcataaggctccccaaagtc
tatacaggccccggcctgagcctgcaccatgctggcctcttcctgctgctgacaacacgc
ctgggtctcactctgctctgggatggaggcacccgggtgctggtacagctgtccccccac
ttccatggtcgtgtggccgggctgtgcggaaactttgatagtgatgccagtaatgatctg
cggagtcgccaaggagtcctggagcccacagcagaactgactgcgcattcctggcgcctc
aatcccctgtgccctgagccaggagacctgccacatccttgtaccgtgaatgcccatcgg
gcaaactgggcccgggcacgctgtgaggtgatattgcagccaatctttgccccatgccac
acagaggtgcccccacagcagtactatgagtggtgtgtgtacgatgcttgtggctgtgac
acagggggtgactgtgagtgcctctgctcagccattgccacatacgctgatgagtgtgcc
cggcacagacaccatgtgcgttggcgcagccaggagctctgccccctacagtgtgaagga
ggtcaggtgtatgaaccctgtggctctacatgtccacccacttgccacgaccaccattct
gagctcagatggcactgccaggtcatcacctgtgtggagggctgcttctgccctgagggg
acactgctgcatggaggagcctgcatgaagctggctgcctgtccctgtgagtggcagggc
agtttcttcccaccagggactgtgctgcaaaaggactgtggaaactgcacgtgtcaggga
agccagtggcattgtgaccgtggtggtgccccatgtgaggacatggaacctggctgtgca
gaaggagagactctgtgcagagagaatgggcactgcgtgccacttgaatggctttgtgac
aatcaggatgactgtggtgacggctcagatgaggagggttgtgccacctcagtctgtggg
gagggacagatgtcttgccagtctggccactgcctgcccctgtccctgatctgtgacggg
caggatgactgtggagatggcacagatgagcaagggtgcctatgtccccatggctctttg
gcctgtgctgatggtcgctgcctaccacctgccctgctgtgtaatggtcatcctgactgt
ctggatgctgcagatgaagagtcctgtctggggcctgtgagctgcatctctggagaggta
tcttgtgttgatggcacttgtgttaggactatccagctatgtgatggagtttgggactgc
ccagatggagctgatgaggggcctagccactgctctctgccttctctgcctactcctcct
gggggcattgggcagaacccttccaccagttccctggatacagcaccgagtcctgtgggt
agtaccagccctgcgtcgccctgcagcctcttggagttccagtgcaacagtggagaatgc
acccctcggggctggcgctgcgaccaggaggaagactgcaccgacggcagcgatgagctt
gactgcggtgggccctgcatgctgtaccaggtgccctgtgcccacagcccacactgcgtg
tccccaggacagctatgtgatggagtgacacagtgccctgatggttcagatgaggacccc
gatgtttgcgaggagcaatcagcctcaggaggcgctaacaggacaggggctccctgtcca
gaattctcctgccctgatggcacttgcattgatttcctgctggtttgtgatgggaaccca
gactgtgaattggcagacgaaacagagccctccctggacgagcagggttgtggggcctgg
ggctcctggggtccatgggcgccatgcagtcagacctgtgggtctggcacacggagtcgg
aaccggaactgctccacatccagtctccaggtgctacagaactgcccgggcctgcagcac
cagtcacaggcctgcttcacagaagcctgcccagtggatggagaatggagctcctggtct
ccctggtctccttgttctgaaccctgtgggggcaccacaacacggcatcgccagtgccgg
ccaccccagaatgggggccaggactgtgccctgttgcctggaagcactcatagcacccgc
cagaccagtccctgccctcaggagggctgcctcaatgccacttgctttggggagttggta
ttccggacttgtgccccctgccctctgacttgtgatgacatttctggtcaggctgcgtgc
cctcctgacaggccctgcagcagcccaggttgctggtgtccagatgggaaggtgctgaac
actgaggggcagtgtgtgagacccaggcagtgtccctgcttggtggatggtgcccattac
tggcctggacaacgcatcaagatggactgccagctctgcttttgccaggatgggcagcca
catcgctgcaggcccaatccggaatgtgctgtggattgtggctggtcttcctggtcccct
tgggcagagtgcctgggtccctgcagcagccagagcctccagtggtcttttcggagccct
aacaacccacgcctctctgggcacggtcgccagtgccgtggcatccaccgcaaagcccgc
aggtgccagacagaggcctgtgagggctgtgaacagtggggcctcatgtacaatgtcggg
gaacgctggcgtgggggcccctgcatggtgtgcgagtgtctacacagcagtatcacacat
tgctccccctattgcccaataggcagctgtccccagggctgggtcctggtggaagggatg
ggagaatcatgttgccactgtgcgctgcctgaaaagaaccagacagtgatccacatgacc
actcctgcccctgcccctgcctctgcccccagccctcagattggagcccatctagtcacc
tatgttctgcctcccacggcagatgcctgctattctcccctgggcctggctggattgccc
atgtgggcaccatcccagcactgggaacacatcaccagggctgaccctgtggaagctccc
atggcagggcctggccccagagagggggcttctgctgagtggcacacccagccactctat
ctacagctggaccttcgtcggcctcggaacctcactggcatcatcgtgcagagggctggc
tcctctgccgcttatgtctccactttgtcactccagtttagcagcgacaatctacagtgg
cacaactatgtcaactctctgtctagtaccctgtctccacccaagccttccccggagagc
tcaaaccatatggcccctgaggtatggacatttgaccagatggtacaggcaaggtacatc
cgggtgtggccacacagtggccacctcagagacaacaaccagcacgatatcttcctgtgg
gtggagctactgggcttgtccccgttggcacccctatgtccagggagcaggcaccgctgt
gccagtggtgaatgtgccccaaagggtggtccatgtgatggtgctgtggactgtgacgat
ggctctgatgaggagggatgtgggtcccttcatgcaagcactaccagcagagtccatccc
atgaccaggaccccagccctctccccgactcagcctggaaagtttcccagggagggtctg
ccagacacagagccccagcagcccaagcaggaatcatccttgcctggtgcaggtgtgtca
ggtctcatccctgcttctgagggtactctgcctgtttcagggcagcccatgcagacactg
tctgctacctccaccttccctcctggtgccaagagcctacacccaggaatggcagctgtg
acggtgcatcctccacactcagtcacaccaggagctcctgttggccaaactgtcagcccc
aggcccttcccacccatgccgtgtggccctgggcaggtgccctgtgatgtgttgggctgt
gtggagcaggaacagctgtgtgatgggagggaagactgtcttgatggatccgatgagcag
cactgtgcaagtgctgagcccttcactgtgcctactactgccctccctgggttaccagcc
tcaaaggccctctgctccccaagtcagctgagatgtggcagtggggagtgtctacctttt
gagcatcgctgtgaccttcaggtgaactgccaggatggctctgatgaagacaactgtgta
gactgtgtgttggcaccttggtctggctggagtgactgcagccgcagctgtggcctgggc
ctcatcttccagcaccgagagctgctaagacttcccctgcctggaggcagctgtctgttg
gaccagttccgtagccagtcctgctttgtgcaagcctgcccagtggccggggcatgggca
gaatgggggccctggacggcctgcagtgtctcctgtggaggtggccaccagagtcgccag
aggagctgtgtggaccctcctcccaagaatggtggtgccccatgccctgggccttcccat
gagaaggcaccctgcaacttgcagctctgcccaggtgacacagactgtgagccaggcctt
gtgcatgtgaatgctgagctgtgccagaaggggctagtgcccccatgtccaccctcctgc
ctggaccccgaagccaacagaagctgcagtgggcactgtatggaaggatgccgctgccct
cctgggctcctcctccaggactctcactgtctgcccctctctgaatgtccctgcctggtg
ggccaaaagctgatacagcccagactggccttcttgctggacaactgcagccaatgcata
tgtgagaaggggacactgctgtgcaagccaggggcctgctcccagtcctgtggctggtct
gcctggtccccctggactgcttgtgatcgctcctgtggctctggagtgagggccaggttc
aggtcccctaccaaccctcctgtggcatttggaggttccccgtgtgaaggtgacaggcag
gaactgcaggcctgctacacagactgtgggacagagataccaggttggacaccctggaca
tcctggtcctcctgctcccagagctgccttgtccctgggggggaccctggctggcggcag
cgttctcggctgtgccctagctctagggacacattctgtcccggagaggccactcaggag
gagccctgcagcccccctgtgtgcccagtgccgagtgcctggggtttatgggcttcctgg
tctacctgctcagcctcctgcaatggtggcatccagactcgtgggcgcagctgctctggt
tctgctcctgggaaccctgtgtgcctaggaccccacactcagaccagagactgcaacatg
catccatgcacagcccagtgtcctgggaacatggtattccgctcagcagagcagtgtctt
gaggaagggggtccgtgccctcagctgtgcctggcacaggaccctggggtggagtgcact
ggctcctgtgctcctagctgcaactgtccccctggcctcttcctgcataatgctagctgc
ctgccccgcagccagtgcccctgccagctgcatgggcagctctatgcaccaggagcagtg
gctcacctagactgcaacaactgcacctgcatctctggagaaatggtgtgcacctcaaag
cgctgtccagtggcctgtggctggagcccctggactccatggagcccttgcagccaaagc
tgtaatgtgggcattcgacggcgctttagagcaggcactgaaccacctgctgcctttggg
ggtgctgagtgccaaggtcccaatctagatgctgaattctgcagtttgaggccatgccga
ggccctggtgcagcatggagttcctggaccccatgctcagtgccctgtggtggtggctac
cgaaaccgcactcaaggcagtggcccgcacagccctatcgagttctctacctgcagcctg
cagccctgtgcaggaccagtgccaggcgtgtgtcccgaggaccaacaatggttggactgt
gcccagggtccagcctcttgtgcccatctcagcatccctggagaggctaaccagacctgc
caccctggctgctactgcctctctggaatgctcctgctaaacaatgtgtgtgtgcctgtc
caggactgcccttgtgcccacagggggcgtctttattccccaggcagtgctgtgcatctt
ccatgtgagaattgctcctgcatctctgggctcatcaccaactgcagctcctggccttgt
gaggaaggccagcctgcatggtcatcctggactccatggagtgtgtgttcagcctcctgc
aaccctgcccgacgccaccggcaccgcttttgtgccaggcccccccatagggcacccttc
agtttggttctgctgaccacagtggctgcccccacaaccctctgcccaggccctgaggct
gaggaagagccgtgcctcctgccaggatgtaatcaagcagggggctggagtccttggagc
ccctggtctggctgtagtcggagctgtggaggaggcctgcggagccggacccgagcctgt
gaccagccgtcaccccagggcctgggggatttttgtgagggacctcaggcccagggggag
gcctgccaggctcagccatgcccagtgaccaactgcagtgccatggaaggggcagagtac
agcccctgtggccctccttgtccccgctcctgtgatgaccttgtgcactgtgtgtggcgc
tgccaaccaggctgctactgtcccctgggcaaggtactgagtgctgatggggccatctgt
gtgaagcccagttactgcagctgcctggacctgctgactggaaagcgccaccatgcaggc
actcagctgatgaggccagatggttgtaaccactgcacctgcatggaggggaggcttaac
tgcacagacctgccctgccaagtgtctggagactggtgtccgtggtccaagtggacagca
tgctcccagccctgcaggggccaaacaaggacccgctccagggcctgtgtctgccctgct
ccccagcatgggggttctccatgtcctgaggagtcagggggaacaggagtacagcatcaa
atggaggcctgccctaatgccactgcatgcccagtggatggagcctggagcccttggggg
ccatggtcttcctgtgacgcatgcctggggcagtcctatcgaagccgggtgtgcagccat
cctcccatctctgacggaggcaaaccttgtcttgggggctatcagcagagtcgcccttgt
cggaacagctccaccctgtgtacagattgtggagggggccaggatctcttaccctgtggg
cagccatgtcctcattcctgccaggatctgtcccttggcagtacatgccagccaggctca
gcaggctgtcagtctggctgtgggtgtcccccaggccagctttcccaggatgggctctgt
gtgtttccagttgactgtcactgccacttccagcctagagccatggggatccctgagaac
cgaagccggtcagtagggtccacactcagctcctgggagagtctagaacctggagaggta
gtgactgggccctgtgacaactgcacctgtgtggcaggtatcctgcaatgccatgaggtg
cccagctgccctggtcctgggatatggagttcctgggggccctgggagaaatgcagtgtt
tcctgtgggggaggggagcagctacggtccaggcaatgtgcccgacccccctgccctgga
ctggctcagcagagccgaatttgtcacatccatgtctgcagaggctgcccagcaggtcga
ctataccgggaatgccagcccagtgatgggtgccccttctcctgtgctcatgtcaccgga
caggtggcctgcttctctgagcgctgtaaggaggggtgtcactgtccagagggcaccttt
cagcatcacgtggcctgtgtccaggagtgcccctgtgtgttgacagtcctgctgctgcag
gagctggggttggctagcgctgccctcggatcctatccaacccttctgggagatgagggc
aagccccttggacctggagttgagctgctcccaggccagatgcttcaaacagactgtgga
aactgctcctgtgttcatgggaagctgtcttgctctatggtggaatgctccagagtgcat
ggcagctttggtccctggggcatgtggagcctttgttcccgctcctgtggtgggttgggt
acccgcacccgaacccgccaatgtgtgcttcccacacttgcgcctggtggactgagctgc
cgtgggccgcttcaggacctggaatactgcttcagcccagaatgccctggaactgcaggg
tccacagtggagccggtgacaggccttgcaggtggctggggcccgtggtctccatggtct
ccgtgttcccacagttgcacagaccctgctcacccggcgtggcgcagccgcacacgcctc
tgtttggctaactgtacagtaggggactcctcacaggaacgtccgtgcaacctgccctca
tgtgcagcgctgctcccgtgccctggccctggctgtgggtcagggaactgtttctggacg
tcctgggccccatgggagccttgctcccgaagctgtggtgtgggccagcagcgtcgccta
agagcatatcacccccctgggcctggtggacactggtgccctgacatcctgactgcgtac
caagagcgccgcttctgcaaccttcgtgcttgtccagtgcctgggggctggtcccactgg
agtccctggtcctggtgtgatcgcagctgtggaggaggtcgatctttgaggagcagaagc
tgctcaagcccaccacccaagaatgggggaacatcctgtgttggggagaggcaccatgtc
cggccctgcaatcccatgccctgtgaggaaggctgcccagcgggcatggagatggtgagc
tgtgccaaccactgcccctacagctgctcagacctgcaggagggaggcatgtgtcaggag
gaccaggcctgccagttgggctgtcgctgctctgaagggtttctggagcaggatggaggc
tgtgtgccagttggacactgtgaatgcacagatgcccagggccgcagctgggccccaggg
agccagcaccaggatgcctgcaacaactgttcctgtcaggctgggcaactctcctgcact
gctcagctttgctcacctcctgcccactgtgcctggagtcactggtctgcctggagttcc
tgcagtcactcctgtggacctcaagggcaacagagtcgctttaggtcctccacgtcaggc
tcgtgggccctggagtgtcagaaggagcagtcacagagccagccttgccctgaggtcccc
tgcccacccctgtgcctacatgaagcccacctccatgagctgggggacaactggctgcat
ggagaatgccagcagtgctcctgcaccccggagggagcgatctgcaaagacactgattgt
gcagtgcccagaggctggacattgtggtcctcctggtcctactgttctgtctcttgcgga
gggggaagccaggtccgcactcgatcctgcacggtgtcagcccctccgcatgggagccta
tcttgcgagggcccagacacccagacccggcactgtgggcagcagttgtgcctgcagaag
ctagaaaggtgctcctggggaccatggggaccctgttcccgcagctgtggcacaggtctg
gcctcccgctctggatcctgtccctgtctactgaccaaagaggactccaagtgtaatgac
acattcttaggcctggacacccaggcctgctactcagggccctgtcaggacgactgcacg
tggggcgactggagcagctggacacgctgctcctgtaaggtcctggtgcagcagcgttac
cgacatcaggtgccagcacctggccaggctggagagggcaccccttgcacccgtctggat
ggccacttcaggccttgtaccattggcaactgctcagaggacagctgcccacctccattt
gagttccagtcttgtggctccccctgtgctgggctctgtgccacacatctgaaccatcgt
ctttgccaggacttaccaccttgccagcctggctgctactgccccaagggcctgctggag
caggctggaagctgcattctcccagagcagtgtaactgctggcatatctcaggcgaggga
gctagggtgaccctggcccctggggaccgcttgcagctgggctgtaaggaatgcgtctgc
cggaggggagagctgcagtgttccagccaagggtgcgaaggtcttctgcctctgactgga
tggtcagagtggtcaccttgtgggccctgcctgccccaaagtgccctagcccctgcctcc
aggactgccctggaggggcactggcctctgaacacatcagacctccctccaccctcagtc
actctgctggcttcagagcagtaccggcaccgcctctgcttggaccctgagacgaggagg
ccctgggcaggagatcctgctctttgtactgtgcctctcagccagcaacgcctctgccct
gaccccggagcctgcaatgacacgtgccaatggggaccttggggaccttggagcccctgc
caaatgccctgcagtggaggattcaagctgcgctggagagtggcaagagacacctctgcg
ggagaatgccctggaccatgggctcaaacagaaagctgcaatatgggatcttgcccagga
gagagttgtgagaccagggacacggtgtttacccttgactgtgccaaccagtgtcctcgc
agctgtgctgacctctgggatggtgttcagtgtttacagggaccctgcagcccaggctgc
cgatgtccccctggtcagctagtgcaggatggacactgtgtccccatctcctcttgccgc
tgtggcctgcccagtgccaatgcctcgtgggagctggcccccacacaggtggtccagctg
gactgccataattgcacatgcatcaatgggaccctgatgtgtccacaccttgagtgtcca
gtcctgggaccttggtcagcttggagtgagtgctcagctgtctgtggtaagggcaccatg
gtgcgccacaggagttgtgaggaacatcctgatcgtgaaccatgccaggctctggatctg
cagcaatggcaagagtgtaacctgcaagcctgtcctgagtgcccacctgggcaggtgctc
agtacctgtgccactatgtgcccgagcctttgctcccacttgtggcctggcaccatctgt
gtgcgggaaccctgccagcttggctgtggctgccctgggggacagctgctatacaacggc
acgtgcattccccctgaggcctgtccctgcacccagttttccctaccctggggcctcacc
ctacccttggaagagcaggcccgggagctgccctcagggactgtgctcactcggaactgc
acacactgcacctgtcaaggtggagccttcatctgctcccttacggactgtcaggagtgc
gctcctggggaaatatggcagcatgggaagctggggccttgcgagaagacatgcccggaa
atgaacatgacacaggcttggagcaactgcactgaggcacaggctccaggctgtgtgtgt
cagctggggtacttccgcagccagacaggtctctgtgttcccgaagaccactgtgaatgt
tggcaccatgggagtccccatttgcctggatctgaatggcaggaggcctgcgagagctgc
cgctgtctgcatgggaagagcgtttgtattcgccactgcccagagctcagctgtgctcag
ggtgaagtgatcatgcaggagccagggagctgttgccccatttgtcagcaagacactctg
agtacggaggaggaggagccagtctcctgcaggtacctcacagaactcagaaacctcacc
aagggtccctgccacctggatcagatagaagtgagctactgcagtggacactgcaggtcc
agcaccaatgtcatgactgaggaaccctacctgcagagccagtgtgactgctgtagctac
agactggatccggacagccccgtgcggatcttgaacctcctttgccccgatggccacaca
gagccagtggtgttgccagtgattcacagctgccagtgcagtgcctgtcagggtggcgat
ttctcaaagcactga

DBGET integrated database retrieval system