KEGG   Mus musculus (mouse): 243535
Entry
243535            CDS       T01002                                 

Name
(RefSeq) cDNA sequence BC048671
Organism
mmu  Mus musculus (mouse)
SSDB
Other DBs
NCBI-GeneID: 243535
NCBI-ProteinID: NP_808406
MGI: 2679261
Ensembl: ENSMUSG00000049694
Vega: OTTMUSG00000037490
UniProt: Q8C5S3
Position
6; 6 D1
AA seq 137 aa
MDSKGHKKPCRHKKKEIKTYERFVKKFPYRLPHLTEPSTSCPPSCKAKSNSLKDKLPLQK
NLVPTRSIPIPGLGAPQVAWPFSFYSPPPHPPLCNLWELKLLQLRFPTQDLPRLPPLQTP
DNQPLTSGISKPPESIP
NT seq 414 nt   +upstreamnt  +downstreamnt
atggactcaaaaggccacaagaagccctgccggcataagaagaaggaaatcaagacttat
gagagatttgtcaagaagtttccttacaggttacctcatttgacggagcctagcacatca
tgcccaccatcttgtaaggccaagagcaactcactgaaggacaaactgcccttacagaag
aatctggtgccaacacggtccatccccatcccagggctcggcgctccgcaagtcgcatgg
ccattcagcttctactcaccacccccacatcccccactgtgtaacctctgggaacttaaa
ttactgcagctccgtttccccacacaagatcttcccaggctgcctcctctgcagacccct
gacaaccagcccctcaccagtgggatttcaaagccacctgagagcattccctag

DBGET integrated database retrieval system