KEGG   Mus musculus (mouse): 243634
Entry
243634            CDS       T01002                                 

Gene name
Ano2, BC033409, Tmem16b
Definition
(RefSeq) anoctamin 2
  KO
K19497  anoctamin-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    243634 (Ano2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    243634 (Ano2)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   243634 (Ano2)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer
Other DBs
NCBI-GeneID: 243634
NCBI-ProteinID: NP_705817
MGI: 2387214
Ensembl: ENSMUSG00000038115
Vega: OTTMUSG00000033377
UniProt: Q8CFW1
Position
6; 6 F3
AA seq 1002 aa
MAAPGLRDIPLLPGSPRRLSSRTVARGSQGPKHGQQYLKVPGHRAPGQRDNSSLHPSQVS
RRESSRDRSVINNYLDANEPPSSEARLSRMHFHDNQRKVDYVLAYHYRKRGAHLGHGSPG
HSLAVISNGETGKERHGGGPGDVELGPLDALEEERREQRDEFEHNLMAAGLELEKDLESK
SQGSVFVRIHAPWQVLAREAEFLKIKVPTKKMYEIKAGGSIAKKFSAILQTLSSPLQPRV
PEHSNNRMKNLSYPFSREKMYLYNIQEKDTFFDNATRSRIVHEILKRTACSRANNTMGIN
SLIANNIYEAAYPLHDGEYDSPGDDMNDRKLLYQEWARYGVFYKFQPIDLIRKYFGEKIG
LYFAWLGLYTSFLIPSSVIGVIVFLYGCATIEEDIPSKEMCDHQNAFTMCPLCDKSCDYW
NLSSACGTARASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLTGIEEEEER
SQEHSRPEYETKVREKLLKESGKSAVQKLEANSPEDDEDDEDKLTWKDRFPGYLMNFASI
LFMIALTFSIVFGVIVYRITTAAALSLNKATRSNVRVTVTATAVIINLVVILILDEIYGA
VAKWLTKIEVPKTEQTFEERLILKAFLLKFVNAYSPIFYVAFFKGRFVGRPGSYVYVFDG
YRMEECAPGGCLMELCIQLSIIMLGKQLIQNNIFEIGVPKLKKLFRKLKDETEPGESDPD
HSKRPEQWDLDHSLEPYTGLTPEYMEMIIQFGFVTLFVASFPLAPVFALLNNVIEVRLDA
KKFVTELRRPDAVRTKDIGIWFDILSGIGKFSVIINAFVIAVTSDFIPRLVYQYSYSHNG
TLHGFVNHTLSFFNVSQLKEGTQPENSQFDQEVQFCRFKDYREPPWAPNPYEFSKQYWSV
LSARLAFVIIFQNLVMFLSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLKEEHEKVKLAD
EPTQRSQGGGDRSRRSRAASSAPSGRSQPGSIASSGSQHTNV
NT seq 3009 nt   +upstreamnt  +downstreamnt
atggcggcccctgggctgcgagacatccctctgctccctggatctccacgtcggctgagt
tctcggaccgtggccagaggaagccagggccccaaacatgggcagcagtacctcaaagtg
ccaggtcaccgggccccaggtcagagggacaattccagcctacaccctagccaggtctcc
aggagagagagttcccgagaccgttctgtcatcaataactacctggatgccaatgagccc
ccgtcctcggaagcccgtctgagccgcatgcactttcacgacaaccagaggaaagtcgac
tatgtacttgcataccactaccggaaacgaggcgcacacctgggtcacggctcccctgga
cactctctggctgttatctccaatggggagacaggcaaggagcgccatggcgggggccct
ggtgatgttgaacttgggccactggatgctctggaagaggaaaggagggagcagcgagat
gaatttgagcacaacctgatggctgctgggctggagctggagaaggacttggagagcaaa
agccagggatctgtctttgtccggatccacgccccatggcaggtgctggccagggaagca
gagttcttgaagatcaaagtccccaccaagaaaatgtacgagatcaaagcaggaggcagc
atcgcaaagaagttcagcgccattctgcagacgctcagttcacccctgcagcccagagtt
cctgaacacagcaacaacaggatgaaaaacctctcctacccattctccagggaaaaaatg
tacctgtacaacatccaggaaaaggacaccttctttgacaatgctacccggagccgcatt
gtacacgagattctgaagcggacggcctgttctcgagccaacaacacgatgggtattaac
tctctaatagcaaacaatatctacgaggctgcctacccgcttcatgatggtgaatatgac
agtccaggggatgacatgaatgacagaaagctgctgtatcaggaatgggcacgctatgga
gtgttttacaaatttcaacccattgacctcatcaggaagtattttggagagaaaattggg
ctatattttgcttggctggggttgtatacatcattcctgatcccatcttctgtcataggc
gtgattgtgtttctttatggatgtgcaacaatcgaggaagatattcccagcaaagagatg
tgtgaccaccagaatgccttcaccatgtgtcccctgtgtgacaagtcctgtgactattgg
aacctcagctcagcctgtgggactgcacgggccagtcatctgtttgacaatccagccacc
gtcttcttttccatcttcatggctctgtgggctaccatgtttctggaaaactggaagaga
ctccagatgcggttgggctacttctgggacctgactgggatcgaagaggaagaagaacgt
tcccaggaacactctcggcctgaatatgaaaccaaagtacgagagaaactgttaaaggag
agtggcaagtcagcggttcagaagctggaagcaaattcacctgaggatgatgaggatgat
gaagataaactgacttggaaagatcgtttcccaggatacttgatgaactttgcctccatc
ttgtttatgattgccctgacgttctccattgtctttggggtcattgtgtatcggatcaca
actgcagctgccctgtctctcaacaaggccacacgctccaatgtccgggtgacagtgact
gcaacagcagtcatcatcaacctcgtggtcatcctcatcttggatgagatctatggtgct
gtggccaagtggcttaccaaaatcgaggttccgaaaacagaacagacttttgaagaacgg
ttgatcctcaaagctttcttgctcaagtttgtcaatgcctactcccccatcttctatgtg
gcctttttcaaggggaggtttgtgggcagacctggaagctatgtctacgtgttcgacggt
taccgcatggaagagtgtgctccgggaggctgtctcatggagctgtgcatccaactcagc
atcatcatgttgggcaagcagctgatccagaacaatatctttgagattggagtcccgaag
ctaaagaaactctttcggaagctgaaagatgagacagagcctggagaaagtgaccctgac
cactcaaaacgtccagagcagtgggacctggaccacagcctagagccttacactgggctg
actcctgagtacatggaaatgatcatccagtttggttttgtcaccctttttgtggcctcc
tttcctctggcccctgtgtttgctctcctcaacaatgtcattgaagtgcggctggatgca
aaaaagtttgttacagaactgagacgcccagatgctgtgaggaccaaagacattggaatt
tggtttgacattctctctggaattggcaagttctccgtcatcattaatgcttttgtcatt
gctgtcacctccgactttatcccccgccttgtgtaccagtactcctatagccacaacggg
acactacatggctttgtgaaccatacactctcctttttcaacgtcagtcagctgaaggag
ggaacacagcctgaaaactcacagttcgaccaggaggttcagttttgcaggttcaaagat
tatcgagaaccaccatgggcaccaaacccttatgagttttccaagcagtactggtctgtt
ttgtctgcccgtctggcctttgttatcatcttccagaacctagtgatgttcctgagtgtc
ctggtggactggatgattccggatatccccactgacatcagcgaccagatcaagaaagag
aagagcttgctggtagacttctttctgaaggaggagcatgagaaggtcaagctggctgat
gagcccacccagaggagccagggaggtggggatcggagcaggaggagccgtgcagccagc
tctgcaccatcaggccggagccagccaggcagcatagcatcctcagggtcccagcacacc
aatgtatga

DBGET integrated database retrieval system