KEGG   Mus musculus (mouse): 243764Help
Entry
243764            CDS       T01002                                 

Gene name
Chrm2, AChR-M2, Chrm-2, M2
Definition
(RefSeq) cholinergic receptor, muscarinic 2, cardiac
  KO
K04130  muscarinic acetylcholine receptor M2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04725  Cholinergic synapse
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    243764 (Chrm2)
   04024 cAMP signaling pathway
    243764 (Chrm2)
   04151 PI3K-Akt signaling pathway
    243764 (Chrm2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    243764 (Chrm2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    243764 (Chrm2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    243764 (Chrm2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    243764 (Chrm2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    243764 (Chrm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 243764
NCBI-ProteinID: NP_987076
MGI: 88397
Ensembl: ENSMUSG00000045613
Vega: OTTMUSG00000036825
UniProt: Q9ERZ4
Position
6; 6 B1
AA seq 466 aa AA seqDB search
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGGTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDDNSRQTCIKIVTKTQKGDACTPTSTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaataactcaactaactcctcgaacaatggtttggctattaccagtccttacaagaca
tttgaagtggtatttattgtccttgtggctggatccctcagtctggtgaccatcattggg
aacattctagtcatggtttccattaaagtcaaccgccaccttcagactgtcaacaattac
ttcttgttcagcctggcctgtgctgacctcatcataggtgttttctccatgaacttgtat
accctctacactgtgattggctactggcctttgggacctgtagtgtgcgacctttggcta
gccttggactatgttgtcagcaatgcctccgttatgaatcttctcatcatcagctttgat
agatacttctgtgtcacaaaacctctaacctacccagttaagcggaccacaaaaatggca
ggcatgatgattgcagctgcgtgggttctttccttcatcctctgggccccagccattctc
ttctggcagttcatcgtaggggtaaggactgtggaagacggggagtgctacattcagttc
ttttccaacgctgccgtcacctttggcactgccattgcggctttctatctgcctgtcatc
atcatgactgtgctctattggcacatatcccgggcgagcaagagcagaataaagaaagaa
aagaaggaaccagtggccaaccaagacccggtgtctccgagtctagtgcaaggaagaatt
gtaaagccaaacaacaacaacatgcctggtggtgatggtggcctggagcacaacaagatc
cagaatggcaaggctccgcgggacggtgggactgaaaactgcgttcagggggaggagaaa
gaaagctccaacgactccacgtctgtcagtgccgtggcctccaacatgagagatgatgag
ataacccaggatgaaaacacggtttccacttccctgggccactccaaagatgacaactct
aggcagacatgcatcaaaattgtcaccaagacccaaaagggtgacgcatgcacaccaaca
agtaccacagtagaactagtgggatcgtcaggtcagaatggtgatgaaaagcagaacatt
gtagcccgcaaaattgtgaagatgaccaagcagcctgccaaaaagaagcctcctccatcc
cgggaaaagaaagtgaccaggacaatcttggctatcctgttggctttcatcatcacgtgg
gcgccatacaatgtcatggtgctcatcaataccttctgtgcaccctgcatccccaataca
gtgtggacaattggctactggctctgttacattaatagcaccatcaaccctgcctgctat
gcactttgtaacgccaccttcaaaaagacttttaagcacctccttatgtgtcattacaag
aacataggcgctacaaggtaa

DBGET integrated database retrieval system