KEGG   Mus musculus (mouse): 243816
Entry
243816            CDS       T01002                                 

Gene name
Gp6, 9830166G18Rik, G, Gm469, Gpvi
Definition
(RefSeq) glycoprotein 6 (platelet)
  KO
K06264  platelet glycoprotein VI
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    243816 (Gp6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    243816 (Gp6)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig
Other DBs
NCBI-GeneID: 243816
NCBI-ProteinID: NP_001156486
MGI: 1889810
Ensembl: ENSMUSG00000078810
Vega: OTTMUSG00000058573
UniProt: P0C191
Position
7; 7 A1
AA seq 313 aa
MSPASPTFFCIGLCVLQVIQTQSGPLPKPSLQAQPSSLVPLGQSVILRCQGPPDVDLYRL
EKLKPEKYEDQDFLFIPTMERSNAGRYRCSYQNGSHWSLPSDQLELIATGVYAKPSLSAH
PSSAVPQGRDVTLKCQSPYSFDEFVLYKEGDTGSYKRPEKWYRANFPIITVTAAHSGTYR
CYSFSSSSPYLWSAPSDPLVLVVTGLSATPSQVPTEESFPVTESSRRPSILPTNKISTTE
KPMNITASPEGLSPPFGFAHQHYAKGNLVRICLGATIIIILLGLLAEDWHSRKKCLQHRM
RALQRPLPPLPLA
NT seq 942 nt   +upstreamnt  +downstreamnt
atgtctccagcctcacccactttcttctgtattgggctgtgtgtactgcaagtgatccaa
acacagagtggcccactccccaagccttccctccaggctcagcccagttccctggtaccc
ctgggtcagtcagttattctgaggtgccagggacctccagatgtggatttatatcgcctg
gagaaactgaaaccggagaagtatgaagatcaagactttctcttcattccaaccatggaa
agaagtaatgctggacggtatcgatgctcttatcagaatgggagtcactggtctctccca
agtgaccagcttgagctaattgctacaggtgtgtatgctaaaccctcactctcagctcat
cccagctcagcagtccctcaaggcagggatgtgactctgaagtgccagagcccatacagt
tttgatgaattcgttctatacaaagaaggggatactgggtcttataagagacctgagaaa
tggtaccgggccaatttccccatcatcacagtgactgctgctcacagtgggacgtaccgg
tgttacagcttctccagctcatctccatacctgtggtcagccccgagtgaccctctagtg
cttgtggttactggactctctgccactcccagccaggtacccacggaagaatcatttcct
gtgacagaatcctccaggagaccttccatcttacccacaaacaaaatatctacaactgaa
aagcctatgaatatcactgcctctccagaggggctgagccctccatttggttttgctcat
cagcactatgccaaggggaatctggtccggatatgccttggtgccacgattataataatt
ttgttggggcttctagcagaggattggcacagtcggaagaaatgcctgcaacacaggatg
agagctttgcaaaggccactaccacccctcccactggcctag

DBGET integrated database retrieval system