KEGG   Mus musculus (mouse): 243874Help
Entry
243874            CDS       T01002                                 

Gene name
Nlrp9b, Nalp-delta, Nalp9b, Nlrp9
Definition
(RefSeq) NLR family, pyrin domain containing 9B
  KO
K22663  NACHT, LRR and PYD domains-containing protein 9
Organism
mmu  Mus musculus (mouse)
Brite
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   243874 (Nlrp9b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT PYRIN LRR_6 T2SSE FtsK_SpoIIIE AAA_25
Motif
Other DBs
NCBI-GeneID: 243874
NCBI-ProteinID: NP_918947
MGI: 2675377
Ensembl: ENSMUSG00000060508
Vega: OTTMUSG00000027189
UniProt: Q66X22
Position
7; 7 A3
AA seq 1003 aa AA seqDB search
MAGSSGYGLLKLLQKLSDEEFQRFKELLREEPEKFKLKPISWTKIENSSKESLVTLLNTH
YPGQAWNMMLSLFLQVNREDLSIMAQKKKRHKQTKYKKFMKTTFERIWTLETNTHIPDRN
YHLIVEVQYKALQEIFDSESEPVTAIVAGTTGEGKTTFLRKAMLDWASGVLLQNRFQYVF
FFSVFSLNNTTELSLAELISSTLPESSETVDDILSDPKRILFILDGFDYLKFDLELRTNL
CNDWRKRLPTQIVLSSLLQKIMLPGCSLLLELGQISVPKIRHLLKYPRVITMQGFSERSV
EFYCMSFFDNQRGIEVAENLRNNEVLHLCSNPYLCWMFCSCLKWQFDREEEGYFKAKTDA
AFFTNFMVSAFKSTYAHSPSKQNRARLKTLCTLAVEGMWKELFVFDSEDLRRNGISESDK
AVWLKMQFLQTHGNHTVFYHPTLQSYFAAMFYFLKQDKDICVPVIGSIPQLLGNMYARGQ
TQWLQLGTFLFGLINEQVAALLQPCFGFIQPIYVRQEIICYFKCLGQQECNEKLERSQTL
FSCLRDSQEERFVRQVVDLLEEITVDISSSDVLSVTAYALQKSSKLKKLHLHIQKTVFSE
IYCPDHCKTRTSIGKRRNTAEYWKTLCGIFCNLYVLDLDSCQFNKRAIQDLCNSMSPTPT
VPLTAFKLQSLSCSFMADFGDGSLFHTLLQLPHLKYLNLYGTYLSMDVTEKLCAALRCSA
CRVEELLLGKCGISSKACGIIAISLINSKVKHLSLVENPLKNKGVMSLCEMLKDPSCVLQ
SLMLSYCCLTFIACGHLYEALLSNKHLSLLDLGSNFLEDTGVNLLCEALKDPNCTLKELW
LPGCFLTSQCCEEISAVLICNRNLKTLKLGNNNIQDTGVRQLCEALSHPNCNLECLGLDL
CEFTSDCCKDLALALTTCKTLNSLNLDWKTLDHSGLVVLCEALNHKRCNLKMLGLDKSAF
SEESQTLLQDVEKKNNNLNILHHPWFEAERNKRGTRLVWNSRN
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctcatctggctatggcttgctgaagcttctgcaaaaactgagtgatgaggag
ttccagagatttaaagagcttctcagagaagagcctgaaaagtttaaactcaaaccaata
tcctggacgaaaatcgagaattcttccaaagaaagcctggtaacgctattgaacacacat
tatccaggacaggcatggaatatgatgttaagcctgtttctacaggtcaatcgggaagac
ctctcaatcatggctcagaaaaagaagagacataaacaaactaaatacaaaaagtttatg
aagactacatttgaaaggatatggacattggagaccaacactcatatacctgatagaaac
taccatttaattgtagaagtccagtacaaagcattgcaggaaatatttgattctgagtca
gagccagtcactgcaattgtagcaggtacaacaggagaaggaaaaaccactttcttaaga
aaagcaatgttggattgggcatcaggagttttactgcagaaccggtttcagtatgttttc
ttcttctctgtcttctcacttaacaataccacagagttaagcttagccgagcttatctca
agtacgttgcctgaatcttcagagacagtggatgatattttatctgatccaaaaagaatc
ttgtttatcctggatggatttgattacctgaaatttgacttggaactcaggacaaacttg
tgcaatgactggaggaagaggctgccaacacaaatcgtcttgagtagtttgctacagaaa
ataatgctcccgggatgttctctgcttcttgaattgggacaaataagtgtaccaaaaatc
cgtcatttgctgaagtatccaagggtgataactatgcaaggattctctgagcggtctgta
gagttctattgtatgtccttctttgataaccagagaggcatagaagtagctgagaattta
aggaataatgaagtactccatttatgcagcaatccttatctatgctggatgttctgtagt
tgtttaaagtggcagtttgacagggaggaggaagggtactttaaggctaaaacagatgcg
gctttcttcacaaactttatggtgagtgcattcaaatcaacatatgcccatagtccgtcc
aaacagaacagagcccgattaaagaccctgtgtaccttggctgtagaaggaatgtggaaa
gagttgtttgtctttgactctgaagatctcaggaggaatgggatatctgaatccgataag
gcagtgtggctgaaaatgcaatttctccagactcacggtaaccacactgtgttttatcat
cctacactacagtcatattttgctgccatgttctatttcctcaaacaagacaaagacata
tgtgtcccagtcattggaagcatacctcaacttctaggaaacatgtatgctcgtggccag
acccagtggctccagttaggcacatttttgtttggactcatcaatgaacaagtcgccgcc
ttactccaaccatgctttggctttatacaacccatatatgtaagacaggaaatcatttgt
tactttaagtgtcttggtcaacaagagtgcaatgagaaactggaaagatcccagactttg
ttctcctgtctgcgtgacagccaggaggaaagatttgttagacaagtggtggatctactt
gaagaaattactgttgatattagtagttcagatgtattatcagtgactgcatatgctctg
cagaaatcctccaaattaaagaaacttcatctgcatatacaaaagacagttttttcagaa
atctactgcccagaccattgtaaaacaagaacttctataggcaaaagacgaaatacagcc
gaatattggaaaacattatgtggcattttctgcaacttatatgtgttggatctggacagc
tgtcagttcaataaaagggccatacaggacctctgtaattcgatgtctccaactcctacg
gtgcccctgactgcttttaagctccaaagcttgtcgtgttccttcatggctgactttgga
gatggttcattatttcacacccttcttcagctacctcacctgaaatacctgaacctgtat
ggcacttatctctccatggatgtgactgagaagctgtgtgctgctctgagatgctcagca
tgcagagtggaggagctgctgttgggtaaatgtggcatctcaagtaaggcctgtggcata
attgcgatttcccttatcaactctaaagtgaaacacctctcattggttgaaaatcccttg
aagaacaaaggagtgatgtcactgtgtgaaatgctgaaggatccaagctgtgtcctgcag
tcactgatgttgtcttactgctgcctcacattcattgcctgtggacatctctatgaagca
cttttgagcaacaaacacctctccctgcttgatctgggatcaaatttcctggaagatact
ggagtgaaccttctgtgtgaagctttgaaagatccaaactgcaccctcaaggagttatgg
ttgccgggttgctttttaacttcacaatgctgtgaggagatctcggctgtcctcatttgc
aatagaaatctaaagaccctgaaactgggcaacaataacatacaagacactggtgtcaga
cagttatgtgaagctctgagtcatcccaactgtaacttggagtgtcttgggttagacctg
tgtgagttcaccagtgactgttgtaaggacctagccttggctctcaccacctgcaaaaca
ctgaatagcttaaatctggactggaaaaccttggaccactctgggctggtggtgctctgt
gaggctttgaatcacaaaagatgtaacctgaagatgcttggactggacaaatctgcgttt
tccgaggaatcacagacattactgcaagatgtggaaaagaaaaataataatctgaatatt
ttgcatcatccctggtttgaggcggaacgcaacaagaggggtactcgtctggtatggaac
agcaggaattga

DBGET integrated database retrieval system