KEGG   Mus musculus (mouse): 243937
Entry
243937            CDS       T01002                                 

Symbol
Zfp536, 9630010P11Rik, Znf536, mKIAA0390
Name
(RefSeq) zinc finger protein 536
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-C2H2_assoc zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-H2C2_5 zf-Di19 DUF3268 GAGA Zn-ribbon_8
Other DBs
NCBI-GeneID: 243937
NCBI-ProteinID: NP_759017
MGI: 1926102
Ensembl: ENSMUSG00000043456
Vega: OTTMUSG00000042179
UniProt: Q8K083
Position
7; 7 B2- B3
AA seq 1302 aa
MEEASLCLGVSSTAPEAEPHLSGPVLNGQYAMSQKLHQITSQLSHAFPELHPRPNPEEKT
PAALEEKAHVPMSGQSMGSQMALLANQLGRDVDNSLNGRVDLQQFLNGQNLGIMSQMSDI
EDDARKNRKYPCPLCGKRFRFNSILSLHMRTHTGEKPFKCPYCDHRAAQKGNLKIHLRTH
KLGNLGKGRGRVREENRLLHELEERAILRDKQMKGSLLQPRSDLKPLAHAQQAPLATCNL
ALPPNHSVPDVAHPAPSPKPANLQEDSVTPAAGFRCTFCKGKFKKREELDRHIRILHKPY
KCTLCDFAASQEEELISHVEKAHITAESAQGQGPNGGGEQSANEFRCEVCGQVFSQAWFL
KGHMRKHKDSFEHCCQICGRRFKEPWFLKNHMKVHLNKLSVKNKSPTEPEVAVPMGGLSQ
EAHANLYSRYLSCLQSGFMAPDKASLNEPSQLYGKGELPAKEKEVLGKLLSPISSMAHSV
PEGDKHSLLGCLNLVPPLKSSCIERLQAAAKAAEMDPVNSYQAWQLMARGMAMEHGFLSK
EHQLSRNHEDPLANTGVLFDKEKREYVLVGADGSKQKMPADLVHSTKVGNQRDLPNKLDP
LEGSREFLSHGLNQTLDYNLQGPGNMKEKPTECPDCGRVFRTYHQVVVHSRVHKRDRKSD
EDALHVGVGLEERRGSGSDQESQSVSRSTTPGSSNVTEESGAGGGLSQTGSAQEDSPHPS
SPSSSDIGEEAGRAGGVQQQALLRDRNLGSAMKDCPYCGKTFRTSHHLKVHLRIHTGEKP
YKCPHCDYAGTQSASLKYHLERHHRERQNGAGPLSGQPPNQEHKDETSSKAPMFIRPDIL
RGAFKGLPGIDFRGGPASQQWTAGMLSSGDHSGQATGMPSELSSDALKGSDLPSKSSHYS
EIGRAYQNIVSNGVNFQGSLQAFMDSFVLSSLKKKDTKDKVPSDAHPMKAHTAEGGEEKA
SMKPSQRKSEKSQYEPLDLSVRPDAPTLPGSSVTVQDSIAWHGCLFCAFTTSSMELMALH
LQANHLGRAKRKDHPTGVTVNCKEQGREASKVSVLPSLQSNKEMALPSAVGVLDSAPEKL
AQGPAKETLGDPKSGQWPNHMDPAFCTFPSDFYKQFGVYPAMVGSGAPGSCLNKNTEGKT
HPDDDAPILIPETTNKNTTDDLSDIASSEDMDSSKGENNEDEELDTEPEMTSKPLSALSK
DGSSEGGDSLLSPGAPQPIQGLVSPLAQAAEEQWHSPGLLPAQDPSAGLPKPERGPPGLE
KPMSMLSVLRAYSADGLAAFNGLASSTANSGCIKRPDLCGKF
NT seq 3909 nt   +upstreamnt  +downstreamnt
atggaagaagcgagtctgtgccttggagtgtcctcgacggcaccggaagctgagcctcat
ctgagcggcccagtcctcaatggccagtatgccatgagccagaagttgcaccagatcact
tcccagctcagccatgcctttcctgagttgcacccgcggcccaacccagaggagaagaca
cctgcggcccttgaggagaaggcccacgtgcccatgagcggacagtccatgggcagccaa
atggcactgctggccaaccagctgggccgtgatgtagacaacagcctcaatgggcgtgtg
gatctgcagcagttcctcaatgggcagaacctaggaatcatgtctcagatgagtgacatt
gaggatgatgcccgaaagaaccggaagtatccgtgtcccctgtgtggcaagcgtttccgg
ttcaatagcatcctctccctgcacatgcgcactcacaccggtgagaagccattcaagtgc
ccctactgcgaccaccgcgcggcccaaaaaggaaacctcaagatccacctgcggacccac
aagctgggcaacttggggaaggggcgcgggcgggtacgtgaggagaaccgtctgctgcac
gagctggaggagagggccatcctgcgggacaagcaaatgaagggcagcctgctgcagcca
aggtctgatctcaagcccttggcacatgcccagcaggccccgttggccacctgcaacttg
gccttgcctcccaaccatagcgtgcccgatgtagcccacccggcaccttcccccaagccg
gccaatttgcaggaggattcggtgaccccggctgcgggcttccgatgcaccttttgcaaa
ggcaaattcaagaagcgagaagagctggatcgccacatccgcattttgcataagccctac
aagtgcacactgtgtgactttgccgcctcccaggaggaggagctcatcagtcacgtggag
aaggcccatatcactgcggagtctgcccagggccagggccccaatggtgggggagagcag
tcagcaaacgagttccgctgtgaggtatgtggccaggtgttcagccaggcctggttcctg
aagggccacatgcgcaagcacaaagactcttttgagcactgctgccagatatgtgggcgg
cgcttcaaagagccttggttcctgaagaatcacatgaaggtccacctcaacaagctatcg
gtgaagaacaaatcccccactgagcctgaggtggcggtgcccatgggtggcctgtcccag
gaggcccatgccaacctatactctaggtacctctcctgcctgcagagtggctttatggcc
ccagacaaagccagtctgaatgagccctctcagctctatggcaagggggagctcccggcc
aaggagaaggaggttctgggaaagctactgtctcccatttccagtatggctcacagtgtc
cccgagggggacaagcactccctcctgggctgcctcaacctcgtgccaccactgaaatcc
agctgcatcgagcggttgcaggcagctgccaaagctgcagaaatggaccctgtgaatagc
tatcaggcctggcagctcatggccaggggcatggccatggaacacggcttcttatctaaa
gagcatcagctctcgcgcaaccacgaagaccctttggcaaacaccggagttctgtttgat
aaggagaagcgggagtacgtgttagtgggagcagatggctccaagcagaaaatgcctgct
gatttggttcacagcactaaagtgggcaatcagagagacctgccaaataagctcgaccct
ctagaaggcagtcgggaatttttgtcacatgggctcaaccagacgctagactacaacctg
cagggtcctgggaacatgaaagagaaacccactgagtgcccggattgtggacgggttttc
cgaacctaccaccaggtggtcgtgcattctcgagtccacaagcgggaccgcaagagcgat
gaggacgctctgcacgtgggtgtgggcctggaggagaggcgaggctcaggcagcgaccag
gagtcccagtcagtgagccgctccaccacacctggctcctctaacgtgactgaggagagt
ggggccggaggtggcctgtcgcagaccggaagcgcccaagaggatagtccacacccctct
tcaccatcttcctcagacatcggcgaggaggccgggagagccggtggcgtccagcagcag
gcgctgcttcgagacaggaacctgggctcggccatgaaggactgcccgtactgtgggaag
actttccggacttcccatcaccttaaggtccacctgaggatacacacaggtgagaagccc
tataagtgtcctcactgtgactatgctggcacccagtcagcgtccctgaagtatcacctg
gagagacaccatcgggagcggcagaatggagccgggcccctgtcaggacagcccccgaac
caggagcacaaggatgagacctctagcaaagcgcctatgttcatcaggccggacatcctt
cgaggggcttttaagggtctccccggaatcgacttccgaggtggtcccgcctctcagcag
tggacagccggcatgctctcctccggagatcattcagggcaggccactggcatgccctca
gagctgtcttcagatgccctaaaaggctccgaccttccttccaaaagctcccactactcg
gagatcggaagagcttatcaaaacatcgtgagcaacggtgtgaatttccaagggtccctg
caggccttcatggacagctttgtcctcagctctttgaagaaaaaggacacaaaggacaag
gtcccgtctgatgcccatcccatgaaagcccatactgcagagggtggagaggagaaagca
agcatgaagccctcccagcgaaagtctgagaagtctcagtacgaacctctggacttgtcc
gtgcggccagacgcccccactctccctggctcctccgtgaccgtgcaagacagcatcgcg
tggcacggctgcttgttctgcgctttcaccacctcgtccatggagctgatggcccttcac
ctccaggccaaccacctaggcagagcaaaacgcaaagatcaccccacaggggtgacagtc
aactgcaaagagcaggggcgggaggccagcaaggtctctgtactgccttccctacagtca
aacaaagagatggcccttcctagcgctgttggtgtgctcgactctgctcctgagaagttg
gcccaagggccagccaaagagactctaggggacccgaagagtggtcagtggcccaaccac
atggaccctgccttttgtacctttccatctgacttctacaaacagtttggcgtttacccc
gctatggttggctcaggggccccgggctcctgcctcaacaagaacaccgaggggaaaacc
cacccagatgacgacgcccctatcctgatcccggaaaccacgaacaaaaacactactgat
gacctctcagatattgcctcctccgaggacatggactcctccaagggagaaaacaatgag
gacgaggagctagacaccgaaccagaaatgacgagcaagcctctgtctgctctcagcaag
gatggcagcagtgagggcggcgacagcctgctgtccccaggcgccccgcagcccatccag
ggactggtctcacctttagcccaagcagccgaggaacagtggcacagcccaggcctcctt
cctgcccaggacccctcggcggggctgcccaaaccagagcggggtcccccgggcttggag
aaacctatgagcatgctgtcggtcctcagggcctacagcgccgatggcttagcagccttt
aacgggcttgctagcagcacagcaaattctggatgtatcaagaggccagacttgtgtggt
aagttttag

DBGET integrated database retrieval system