KEGG   Mus musculus (mouse): 243979
Entry
243979            CDS       T01002                                 

Symbol
Mrgprb2, 4833406I20Rik, Mgrg14
Name
(RefSeq) MAS-related GPR, member B2
  KO
K08396  Mas-related G protein-coupled receptor member X
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    243979 (Mrgprb2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Mas proto-oncogene and Mas-related (MRGs)
    243979 (Mrgprb2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 243979
NCBI-ProteinID: NP_780740
MGI: 2441674
Ensembl: ENSMUSG00000050425
Vega: OTTMUSG00000046627
UniProt: Q3KNA1 W8W3G3
Position
7; 7 B4
AA seq 338 aa
MSGDFLIKNLSTSAWKTNITVLNGSYYIDTSVCVTRNQAMILLSIIISLVGMGLNAIVLW
FLGIRMHTNAFTVYILNLAMADFLYLCSQFVICLLIAFYIFYSIDINIPLVLYVVPIFAY
LSGLSILSTISIERCLSVIWPIWYRCKRPRHTSAITCFVLWVMSLLLGLLEGKACGLLFN
SFDSYWCETFDVITNIWSVVFFGVLCGSSLTLLVRIFCGSQRIPMTRLYVTITLTVLVFL
IFGLPFGIYWILYQWISNFYYVEICNFYLEILFLSCVNSCMNPIIYFLVGSIRHRRFRRK
TLKLLLQRAMQDTPEEEQSGNKSSSEHPEELETVQSCS
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgagtggagatttcctaatcaagaatctaagcacctcagcctggaaaacgaacatcaca
gtgctgaatggaagctactacatcgatacttcagtttgtgtcaccaggaaccaagccatg
attttgctttccatcatcatttccctggttgggatgggactaaatgccatagtgctgtgg
ttcctgggcatccgtatgcacacgaatgccttcactgtctacattctcaacctggctatg
gctgactttctttacctgtgctctcagtttgtaatttgtcttcttattgccttttatatc
ttctactcaattgacatcaacatccctttggttctttatgttgtgccaatatttgcttat
ctttcaggtctgagcattctcagcaccattagcattgagcgctgcttgtctgtaatatgg
cccatttggtatcgctgtaaacgtccaagacacacatcagctatcacatgttttgtgctt
tgggttatgtccttattgttgggtctcctggaagggaaggcatgtggcttactgtttaat
agctttgactcttattggtgtgaaacatttgatgttatcactaatatatggtcagttgtt
ttttttggtgttctctgtgggtctagcctcaccctgcttgtcaggatcttctgtggctca
cagcgaattcctatgaccaggctgtatgtgactattacactcacagtcttggtcttcctg
atctttggtcttccctttgggatctattggatactctatcagtggattagcaatttttat
tatgttgaaatttgtaatttttatcttgagatactattcctatcctgtgttaacagctgt
atgaaccccatcatttatttccttgttggctccattaggcaccgaaggttcaggcggaag
actctcaagctacttctgcagagagccatgcaagacacccctgaggaggaacaaagtgga
aataagagttcttcagaacaccctgaagaactggaaactgttcagagctgcagctga

DBGET integrated database retrieval system