KEGG   Mus musculus (house mouse): 244091
Entry
244091            CDS       T01002                                 
Symbol
Fsd2, 9830160G03Rik, Spryd1
Name
(RefSeq) fibronectin type III and SPRY domain containing 2
  KO
K24490  fibronectin type III and SPRY domain-containing protein 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    244091 (Fsd2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   244091 (Fsd2)
SSDB
Motif
Pfam: fn3 SPRY PRY Pur_ac_phosph_N Apolipoprotein POTRA_3 TelA RNase_Y_N
Other DBs
NCBI-GeneID: 244091
NCBI-ProteinID: NP_766492
MGI: 2444310
Ensembl: ENSMUSG00000038663
UniProt: Q8BZ52 Q8C1E6
Position
7:complement(81184102..81216729)
AA seq 716 aa
MEEEAEEESGLGRSAAPKDFHFYHMDLYDSEDRLQLFPGDSSRIRREVTQAEDDRELGDE
FVDEHRLGTLGYPSYGMRRRDPGREPRDWGEAAEAEDLGYGGGQGPLDQCQDLREAYRYT
HGRASEEYECYVIPEEEDEEEPADVFCITCKTPVRTVEKDFDTHKEHEVTPISKALEHAK
DEVHKNMCKLEQQIIEMENFASHLEEVFITVEENFGRQEQNFECHYNGILETLAQKYEEK
IQALGEKKREKLEALYGQLVSCGENLDACRELMETVEEMCHEEKVEFLKDAVAMTDRLGK
FLKTKTDVELSAQPEFEDQTLDFSDVEQLMDAINTIPAPSAPVINPQAPNSATGSSVRVC
WSLYSDDTVESYQLSYRPVQDSSSGKDRAEFTMMVKETYCSVTNLEPNTQYEFWVIAQNR
TGPSPCSEHAVYMTAPSPPSIKTEAIRSCEEAVLICWESGNLNPVDSYTVELIQAETPEA
SGVTESVVGIPTCESLIQLQPRHSYTIYVRALNVGGTSARSEPATVHTTGSYFQLNKDTC
HPWLTISEDGFTVVRSEKKSFRKELPPSKTQFTRCVAVMGNLIPVRGRHYWEVEVAEHLD
YTVGVACEDVPKQEDLGANSLSWCMRHTFVSKRHRYEFLHNKMTPDIRITVAPRKIGVLL
DYENAKLSFFNVDIAQHLYTFSCQLHQFVHPCFSLEKSGCLKICNGISMPKHVTFF
NT seq 2151 nt   +upstreamnt  +downstreamnt
atggaggaggaagcagaggaggaatccgggctgggcaggtcggcagcccccaaagacttc
cacttttatcacatggacctgtatgactctgaagatagactgcagctcttcccaggagac
agcagcagaatcaggagggaagtaacccaagccgaagatgaccgtgaattaggggatgaa
tttgtggatgaacacagactggggactctggggtatccttcttacgggatgaggaggagg
gacccaggcagggagccgagagactggggtgaggcagctgaggcggaggacctgggctac
ggaggagggcaaggccctcttgaccagtgccaagacctccgggaagcctacaggtacaca
catggccgtgccagcgaggagtatgaatgctatgtcatcccagaggaggaagacgaagaa
gagcctgctgatgtcttctgcatcacttgcaaaactccagtaagaactgttgagaaggat
tttgatacacacaaggaacacgaagtaaccccaatcagcaaagctctggaacatgccaag
gatgaggttcacaaaaatatgtgcaaattggaacagcagataattgagatggaaaatttc
gctagccacctggaagaagtgttcattactgtggaggagaattttggaagacaggaacaa
aactttgagtgccattacaatgggatcttggaaaccctcgctcaaaagtatgaagaaaaa
attcaagctctgggggagaaaaagagagagaaactggaagccttatacggacaactggtc
agctgtggagagaacctcgatgcctgcagggagctgatggaaaccgtagaggagatgtgt
catgaggaaaaggtggagttcttaaaggatgcagtggctatgactgacagactggggaaa
ttcctgaaaaccaaaactgatgtggagctctctgcacaacctgagtttgaagaccagacc
ttggacttctctgatgtggagcagctgatggacgccatcaataccattccagcgccctct
gctccagtgataaatccccaggcacccaactccgccaccggctcctcagtgcgtgtatgc
tggagcttatattctgacgacaccgtggagagctaccagctgtcctataggccggtgcag
gacagctcatctggcaaggaccgagcagaattcaccatgatggtcaaagaaacatattgc
tcagtgacaaatcttgagccaaatactcagtatgagttttgggtcatagctcagaacagg
actggccccagcccctgcagtgagcacgcagtgtatatgacagccccctctcccccctct
ataaaaaccgaggcaatcagaagctgtgaagaggctgtgctgatttgctgggagtctggg
aacctgaatccggtggactcctacacggtggagctaatccaggcagagacgccagaagcc
tcgggggtaactgaatctgtcgtaggcatcccaacctgtgaatccctgatacagctgcag
cctagacacagctataccatctatgtgcgagccctcaacgtgggaggcaccagtgccaga
agtgagcctgctacagtgcacaccacaggaagctacttccaattgaacaaagacacctgc
catccctggctgaccatttctgaagatgggtttacggtagttcgaagtgagaagaaaagt
ttcagaaaggagctgccgccgagcaagacgcaatttaccaggtgtgttgctgtcatgggg
aatctgattccggtccgagggcgccattactgggaagtggaggtggctgagcatttggac
tacactgtgggtgtggcctgtgaagatgtccctaagcaggaagacctgggagcaaactcc
ttgtcctggtgcatgaggcatacatttgtttccaaaaggcaccggtatgagtttctgcac
aacaagatgactccagacatcaggatcacagttgctccgaggaagattggcgtgctgctg
gactatgagaacgccaagctgtcctttttcaatgtggacattgctcagcacctgtacaca
tttagctgtcagctccaccagtttgtgcatccctgcttttccctggaaaagtctggatgc
ctaaagatctgcaatggcatttcaatgccaaagcatgtcactttcttttag

DBGET integrated database retrieval system