KEGG   Mus musculus (mouse): 244178
Entry
244178            CDS       T01002                                 

Gene name
Ubqln3, 4933400K24Rik
Definition
(RefSeq) ubiquilin 3
  KO
K04523  ubiquilin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    244178 (Ubqln3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    244178 (Ubqln3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    244178 (Ubqln3)
   03051 Proteasome [BR:mmu03051]
    244178 (Ubqln3)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    244178 (Ubqln3)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    244178 (Ubqln3)
SSDB
Motif
Pfam: ubiquitin STI1 Rad60-SLD UBA YukD DUF2407 Ubiquitin_5 Rad60-SLD_2
Other DBs
NCBI-GeneID: 244178
NCBI-ProteinID: NP_941025
MGI: 3045291
Ensembl: ENSMUSG00000051618
Vega: OTTMUSG00000019032
UniProt: Q8C5U9 Q497R3
Position
7; 7 E3
AA seq 658 aa
MAKSGEALPQGSLAPAQDSQLIRVTVKTPKDKEDFSVVDTCTIRQLKEKISHRFKAHPNQ
LVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTIGTECPSPPVSIPGPNPGEIPQS
SSVYSVDGSPSFSLGVLTGLSGLGLTSGSFSDQPGSLMWQHISVPELVAQLVDDPFIQGL
LSNTGLVRQLVLDNPHMQHLIQQNPEIGHILNNPEIMRQTMEFLRNPSMMQEMMRSQDRA
LSNLESIPGGYNVLRTMYTDIMDPMLNAVQEQFGGNPFVTATTASTTTTSSQPSRTENCD
PLPNPWTSTYGVSGGRQGRGGRQSGDQDASENRNRLPSFLGNIGLFDYLQQLHETSQSLE
SYLQGTVPTSNPSQESPLSGNRVPPTLPSSPKSGSGQSLPKESVAIKGKSSCPAFLRHST
ENSTGQGGSLHDAGKGSTGPSTSLPNLTSQIGDSANRSSFVSTPSSLMSATPGVPESPWL
PPTGYSRSLRSAGTNQVPRIQNEIHQQLPLLLHLQTAMANPRVMQALLQIEQGLQILATE
APRLLLWFMPCLTGLNGVTGGTEAREGVVMSEDPRPTPTPQISLAQGSTELGIHSSPFLQ
VLQALASTNPQQLQLEAHFRVQLEQLRAMGFLNLEANLQALIATEGDVDAAVEKLRKS
NT seq 1977 nt   +upstreamnt  +downstreamnt
atggccaaaagtggagaggctctaccacagggcagcctagcgccagcccaggattcccag
ctcatccgggtgacagtgaagacacccaaggacaaggaggatttctcagttgtagacaca
tgcaccatccggcagctaaaggaaaaaatatcacaccgctttaaggcacatccaaatcag
ctggtcctgatctttgctggaaaaatcctcaaggaccctgactcattggcacagtgtgga
gtgcgagatggcctcacagtccacctggtcatcaagatgcagcgtcggaccataggcaca
gagtgcccatcaccaccagtctctattccaggcccaaatcctggagaaatccctcagtca
agttctgtttactctgtggatgggtctccttctttcagcttaggggtcctcacaggcctc
agtgggttaggtctgacctcaggaagcttctctgaccagccaggctcactaatgtggcag
cacatctcagtgcctgaacttgtggctcagctcgttgatgacccctttatccagggtctg
ctgtccaacacgggcctagtgcgccagttggttcttgacaatcctcacatgcagcacctg
atccagcagaaccctgagattggtcatattcttaacaaccctgagatcatgcggcagaca
atggagtttcttcgtaacccttccatgatgcaggagatgatgcgtagccaggatcgtgca
ctcagtaacctggagagcatccctggtggctacaatgtgctccgtactatgtacacagat
attatggatcccatgcttaatgcagtacaggaacaatttggtggcaatccttttgtcact
gctactactgctagtaccaccaccaccagcagccaaccatcaaggacagagaattgtgac
cctctgcccaacccctggacttccacatatggggtctcaggtggaagacaaggaagaggt
ggcagacagtctggggaccaggatgcatctgaaaatagaaataggcttccaagctttctg
ggtaacataggactctttgattatcttcaacagttacatgagacttctcagtccctggaa
tcttatctgcagggtactgtgccaacttcaaatccaagccaggaatcaccactttcagga
aacagagttcctccaactttaccatcatcccctaaatctgggtcaggccaatctctgccc
aaagagtcagtagcaatcaagggaaagtcatcatgcccagctttcttgagacactcaact
gagaacagtactggacaaggtggaagcctacatgatgcagggaagggctctactggcccc
agtactagcttgcccaatcttacctctcagataggagattctgccaacagatcctcgttt
gtttctacaccatcttcccttatgtcagctactcctggagtcccagaatctccctggctt
cctccaacaggttactcaagatctctgagatcagcgggcacaaatcaagtccctcgaatc
cagaatgagatacatcaacagctaccactactgttgcatcttcagacagccatggcaaat
ccccgtgtcatgcaagccttgctgcagattgagcagggtctacagattctggctactgaa
gcaccccgcctcctgctctggttcatgccctgcctaacagggttgaatggagtaacagga
ggcacagaagctagagaaggtgttgttatgtctgaggatccccgaccaaccccaactcct
cagatttctctagcacaaggttctacagagctaggtatccattcctcccccttcctccag
gtgttacaagccttagctagtaccaatccccagcagctacaactggaggctcacttccgg
gtacaactggagcaactgcgggctatgggctttctgaatcttgaagccaatctccaggcc
ctcattgctacagagggtgatgtagatgctgctgtggagaaattgaggaagtcttag

KEGG   Mus musculus (mouse): 54609
Entry
54609             CDS       T01002                                 

Gene name
Ubqln2, Cha, Chap1, Dsk, Dsk2, HRIHFB21, HRIHFB2157, Pli, Plic-2, Plic2
Definition
(RefSeq) ubiquilin 2
  KO
K04523  ubiquilin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    54609 (Ubqln2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    54609 (Ubqln2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    54609 (Ubqln2)
   03051 Proteasome [BR:mmu03051]
    54609 (Ubqln2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    54609 (Ubqln2)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    54609 (Ubqln2)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD YukD Rad60-SLD_2 DUF2407 Ubiquitin_5 Atg8 Tir_receptor_C Ubiquitin_4
Other DBs
NCBI-GeneID: 54609
NCBI-ProteinID: NP_061268
MGI: 1860283
Ensembl: ENSMUSG00000050148
Vega: OTTMUSG00000019381
UniProt: Q9QZM0
Position
X; X F3
AA seq 638 aa
MAENGESSGPPRPSRGPAAAPGAASPPAEPKIIKVTVKTPKEKEEFAVPENSTVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLMQHGIHDGLTVHLVIKSQNRPQGQATTQPSTTA
GTSTTTTTTTTAAAPAATTSSAPRSSSTPTTTNSSSFGLGSLSSLSNLGLNSPNFTELQN
QMQQQLLASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPD
IMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGG
NPFATVGSSSTSGEGTQPSRTENRDPLPNPWAPPPTTQTAATTTTTTTTSSGSGSGSSSS
STTAGNTMAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDMA
AQMMLSSPLFTSNPQLQEQMRPQLPNFLQQMQNPETIAAMSNPRAMQALMQIQQGLQTLA
TEAPGLIPSFAPGVGMGVLGTAITPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPASSPG
STGTGIPPATTVSSSAPTETISPTSESGPNQQFIQQMVQALTGGSPPQPPNPEVRFQQQL
EQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggctgagaacggcgagagcagcggccccccgcgcccctcccgcggccctgcggcggcc
ccaggcgcggccagcccgccggccgagcccaaaatcatcaaagtcactgtgaagaccccc
aaagagaaggaggagttcgcggtgcccgagaacagcaccgtgcagcagttcaaggaagcg
atttccaaacgcttcaaatcgcagaccgatcagctcgtgctgattttcgccggaaagatc
ctgaaagatcaagataccttgatgcagcatggcatccatgatggactgactgttcacctg
gttatcaaaagccagaaccgtccgcagggccaggccaccacgcagcccagcacgactgcg
ggaacgagcacgacgaccacgaccaccaccacggcggcggcgccggcggcgacgacatca
tcggctcccaggagtagctccacacctaccaccacgaatagcagctcctttgggctggga
agcctttccagccttagtaacctgggcttgaactcgcccaacttcaccgagcttcagaac
cagatgcagcagcagctcctggccagccctgagatgatgatccagatcatggaaaatccc
tttgttcagagcatgctttcgaatcctgatctgatgaggcagctcatcatggccaatcca
cagatgcaacaattgatccagagaaacccagaaatcagccacctactgaacaacccagat
ataatgaggcagacgctggaaatcgccaggaatcctgccatgatgcaagagatgatgcga
aatcaagacctggctctcagtaatctcgaaagcatcccaggtggctacaatgctctgcgg
cgcatgtacactgacattcaagaacctatgctgaatgccgcacaggagcagtttgggggc
aacccgtttgccacggtggggagcagttccacctcaggggaaggtactcagccctcccgc
acggagaatcgtgatccgctgcccaatccttgggcaccaccgccaacaacccagacggct
gcgaccaccaccaccaccacgaccacaagcagtggcagtggctctggcagcagctccagc
agcaccaccgccgggaacaccatggctgcagctaattacgtggctagcatcttcagcacc
ccaggaatgcagagcctgctgcagcagataactgagaatccccagctgattcagaatatg
ctgtctgcgccctacatgcggagcatgatgcagtcgctgagccagaatccagatatggcg
gcccagatgatgctgagtagcccgctgttcacttcgaatcctcagctgcaggagcagatg
cgtccacagctcccgaatttcctgcagcagatgcagaatccagaaaccatcgcggccatg
tcaaacccgagagcgatgcaagcgctaatgcagatccagcaggggctacagactctagcc
actgaagcacctggcctcattcccagcttcgctccaggtgtggggatgggagtgctggga
accgccataacccctgtgggcccagtcactcccatagggcccatcggccctatagttcct
ttcacccccataggccccatcgggcctataggacccactggccctgcaagctcccccggc
tccaccggcactggcatcccgcctgcaaccactgtgtccagctctgcacctactgaaacc
ataagtccaacctcggaatctggacccaaccagcagttcattcaacaaatggtgcaggct
ctcactggaggaagccctccacagccgccgaatcctgaagtgagatttcagcagcaactg
gaacagctcaacgccatggggttcttaaaccgcgaagcaaacttgcaggccctaatagca
acaggaggcgacatcaacgcggccattgagaggctgctgggctctcagccatcctaa

KEGG   Mus musculus (mouse): 56085
Entry
56085             CDS       T01002                                 

Gene name
Ubqln1, 1110046H03Rik, 1810030E05Rik, AU019746, C77538, D13Ertd372, D13Ertd372e, DA4, Da41, Dsk, Dsk2, Pli, Plic-1, Plic1, XDR, Xdrp1
Definition
(RefSeq) ubiquilin 1
  KO
K04523  ubiquilin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56085 (Ubqln1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    56085 (Ubqln1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56085 (Ubqln1)
   03051 Proteasome [BR:mmu03051]
    56085 (Ubqln1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    56085 (Ubqln1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    56085 (Ubqln1)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD Rad60-SLD_2 YukD Ubiquitin_5 DUF2407 CUE
Other DBs
NCBI-GeneID: 56085
NCBI-ProteinID: NP_081118
MGI: 1860276
Ensembl: ENSMUSG00000005312
UniProt: Q8R317 Q3TN93
Position
13 B1; 13 30.95 cM
AA seq 582 aa
MAESAESGGPPGAQDSAADGGPAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRF
KSHIDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDNSAQQTNAPGSTVTS
SPAPDSNPTSGSAANSSFGVGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQI
MENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQ
EMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASLVSSSSSAEGT
QPSRTENRDPLPNPWAPQTSQSSPASGTTGSTTNTMSTSGGTATSTPAGQSTSGPSLVPG
AGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMLQSLSQNPDLAAQMMLNNPLFAG
NPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTP
GLAAGNSGGSSGTNAPSTAPSEDTNPQGGTAEPGHQQFIQQMLQALAGVNPQLQSPEVRF
QQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggccgagagcgcagagagcggcggcccaccgggcgcgcaggacagtgcggccgacggc
ggccccgcagagcccaagatcatgaaggtcacggtgaagacgcctaaagagaaggaggag
tttgccgtgcccgagaacagctcggtccagcagttcaaagaggaaatctctaaacgtttc
aaatctcatattgaccaacttgtgttgatatttgctggaaaaattttaaaagatcaagat
actctgagtcagcatgggattcatgatggacttacggttcaccttgtcatcaaaacacag
aacaggccgcaagataattcagctcagcaaacaaatgcccctggaagcactgtgaccagc
tcaccagctcccgatagcaaccccacgtctggttctgctgctaacagctcctttggcgta
ggcggacttggaggacttgcaggtcttagcagcttgggtttaaacaccaccaacttctct
gaactccagagccaaatgcagcggcaacttttgtctaaccctgaaatgatggtccagatc
atggaaaatccctttgtccagagcatgctctcaaatcctgacctgatgcggcaattgatt
atggccaatccacagatgcaacagttgatacagagaaatccagagattagtcatatgctt
aataatccagatataatgagacaaacactggaacttgcgagaaatccagcgatgatgcag
gaaatgatgagaaaccaggaccgagccttgagcaacctagaaagtattcctgggggctat
aatgccttacggcgcatgtacaccgatatccaggagcctatgctgaatgctgctcaagaa
cagtttggtggtaatccatttgcgtccttagtgagcagttcgtcctcagcagaagggact
cagccttctcgaacagaaaatagggatccgctccccaacccgtgggctccgcagacttcc
cagagctcaccagcctccggtaccactggcagcaccactaacaccatgagcacctctggt
ggcactgccaccagtacccctgctggacagagcacctcgggcccaagcttggtgcctggc
gcaggagctagtatgttcaacacccccggaatgcagagcctgctgcagcagataactgag
aacccacagctcatgcagaacatgctgtccgccccatacatgaggagcatgctgcagtcc
ctgagccagaaccccgaccttgctgcgcagatgatgctgaataatcccctatttgctgga
aatcctcagcttcaagaacaaatgagacaacagctcccaactttcctccaacaaatgcag
aaccccgacacgctctcagcgatgtcgaatcctagagccatgcaggcgctgctgcagatc
cagcagggcttgcagacgctggccacagaagctcctggcctcatcccagggtttactcct
ggcttggcagcaggcaattctggaggctcttccggaaccaatgcacctagcactgcacct
agtgaagatacgaacccccaagggggcactgctgagccaggccaccagcagtttatccag
cagatgctgcaggcccttgcgggggtgaatcctcagctgcagagtccagaagtcagattt
cagcaacaactggaacaactcagtgccatgggattcttgaaccgtgaagcaaacctgcaa
gctctgatagccacagggggcgacatcaatgcagcaatcgaaaggttgctgggctcccag
ccgtcatag

KEGG   Mus musculus (mouse): 94232
Entry
94232             CDS       T01002                                 

Gene name
Ubqln4, A1Up, A1u, AI663987, CIP75, UB, UBIN
Definition
(RefSeq) ubiquilin 4
  KO
K04523  ubiquilin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    94232 (Ubqln4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    94232 (Ubqln4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    94232 (Ubqln4)
   03051 Proteasome [BR:mmu03051]
    94232 (Ubqln4)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    94232 (Ubqln4)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    94232 (Ubqln4)
SSDB
Motif
Pfam: ubiquitin STI1 UBA Rad60-SLD Ubiquitin_5 YukD Rad60-SLD_2 DUF2407 CUE HOIP-UBA Arm_2
Other DBs
NCBI-GeneID: 94232
NCBI-ProteinID: NP_277068
MGI: 2150152
Ensembl: ENSMUSG00000008604
Vega: OTTMUSG00000052160
UniProt: Q99NB8
Structure
PDB: 
2KNZ

Position
3; 3 F1
AA seq 596 aa
MAEPSGAETRPQIRVTVKTPKDKEEIVICDQASVKEFKEEISRRFKAQQDQLVLIFAGKI
LKDGDTLSQHGIKDGLTVHLVIKTPQKAQDPVTAAASPPSTPDSASAPSTTPASPAAAPV
QPCSSGNTTSDAGSGGGPSPVAAEGPSSATASILSGFGGILGLGSLGLGSANFMELQQQM
QRQLMSNPEMLSQIMENPLVQDMMSNPDLMRHMIMANPQMQQLMERNPEISHMLNNPELM
RQTMELARNPAMMQEMMRNQDRALSNLESVPGGYNALRRMYTDIQEPMFTAAREQFGNNP
FSSLAGNSDNSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGTGGSGTSQVHPTVSNP
FGINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAPYMRTMMQTLAQNPDFAAQMMV
NVPLFAGNPQLQEQLRLQLPVFLQQMQNPESLSILTNPRAMQALLQIQQGLQTLQTEAPG
LVPSLGSFGTPRTSVPLAGSNSGSSAEAPTSSPGVPATSPPSAGSNAQQQLMQQMIQLLS
GSGNSQVPMPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQLS
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggcggagccgagtggggctgagacgaggccccagattcgggtcaccgtcaagaccccc
aaggacaaggaggagatcgtgatctgcgatcaagcctcggtcaaggagttcaaggaggag
atctcccggaggtttaaggctcagcaggatcagctggtcctgatcttcgcaggcaagatc
ctcaaggatggggacaccctgagccagcacggcatcaaggatgggctcacagtccaccta
gtcatcaaaacccctcagaaggctcaagatccagtgactgctgctgcttctcctccatcc
actcctgactctgcctctgcaccctccaccacgcctgcctcacctgccgccgcccctgtc
cagccctgcagctctggcaatacaacttcagatgctggcagtggaggggggccctctcca
gtggctgcagaggggccctcaagtgctactgcatcgatcctctctggcttcggaggcatc
ctgggactgggcagcctgggcctgggctccgccaactttatggagctgcagcaacagatg
cagagacagctcatgtccaatcctgagatgctgtcgcagatcatggagaaccccttggtc
caggatatgatgtcaaaccctgatctgatgcgccacatgatcatggctaatccccagatg
cagcagctgatggagaggaaccccgagatcagccacatgctcaacaacccagagctcatg
aggcagacaatggagcttgctcgtaacccagccatgatgcaagaaatgatgcggaaccag
gaccgggccctcagcaacctggaaagtgtcccgggagggtataatgccctccgccgcatg
tacacggacatccaggagcccatgttcactgctgctcgggaacagtttggcaacaatccc
ttctcttccctggccgggaactccgacaactcatcctcccaacctcttcggactgagaat
cgagagcccctccctaacccctggagcccctcgccccccacctcccaggcccccgggtcc
ggtggggagggcaccggaggatcggggaccagccaggtgcacccgacagtctcgaacccc
tttgggatcaatgcggctagcctggggtcagggatgttcaacagcccagaaatgcaggcg
ctcctccagcagatttctgaaaacccccagctgatgcagaatgtcatctcagccccttac
atgcgcaccatgatgcagacgcttgcccagaaccctgactttgctgctcagatgatggtg
aatgtgccgctgttcgcagggaatccacagcttcaggagcagctccgcctgcagctcccc
gtgtttctgcagcagatgcaaaacccagagtctctctccatcctcaccaatccccgggcc
atgcaggccctgctgcagatccagcagggactacagaccctccagactgaagcccctggg
ctggtacccagccttggctcctttgggacaccccggacctcggtacctctggcaggcagc
aactctggatcttcggcagaggcccccacttcttccccgggcgtgccagccacatctcct
cccagtgcgggttccaatgcccagcaacaactcatgcagcagatgatccaacttttgtcc
ggaagtgggaactcacaggtgccgatgccagaagtgagatttcaacagcagctggaacaa
ctcaactccatgggctttattaaccgtgaggccaacctacaggccctgatcgccacagga
ggggacatcaatgccgctattgagagactcctgggctcccagctctcctga

DBGET integrated database retrieval system