KEGG   Mus musculus (mouse): 244202
Entry
244202            CDS       T01002                                 

Symbol
Nlrp10, 6430548I20Rik, Na, Nalp10, Napl10, PAN5, Py, Pynod
Name
(RefSeq) NLR family, pyrin domain containing 10
  KO
K22266  NACHT, LRR and PYD domains-containing protein 10
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    244202 (Nlrp10)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    244202 (Nlrp10)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    244202 (Nlrp10)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   244202 (Nlrp10)
SSDB
Motif
Pfam: NACHT PYRIN NOD2_WH AAA_16 NB-ARC AAA_30 NLRC4_HD2 TsaE Ploopntkinase2 AAA_14 RNA_helicase AAA AAA_33 AAA_19 Zeta_toxin cobW AAA_22 VirE AAA_7
Other DBs
NCBI-GeneID: 244202
NCBI-ProteinID: NP_780741
MGI: 2444084
Ensembl: ENSMUSG00000049709
Vega: OTTMUSG00000060096
UniProt: Q8CCN1 Q6JGS9 Q3V3Z6
Structure
PDB: 
2DO9

Position
7; 7 E3
AA seq 673 aa
MALARANSPQEALLWALNDLEENSFKTLKFHLRDVTQFHLARGELESLSQVDLASKLISM
YGAQEAVRVVSRSLLAMNLMELVDYLNQVCLNDYREIYREHVRCLEERQDWGVNSSHNKL
LLMATSSSGGRRSPSCSDLEQELDPVDVETLFAPEAESYSTPPIVVMQGSAGTGKTTLVK
KLVQDWSKGKLYPGQFDYVFYVSCREVVLLPKCDLPNLICWCCGDDQAPVTEILRQPGRL
LFILDGYDELQKSSRAECVLHILMRRREVPCSLLITTRPPALQSLEPMLGERRHVLVLGF
SEEERETYFSSCFTDKEQLKNALEFVQNNAVLYKACQVPGICWVVCSWLKKKMARGQEVS
ETPSNSTDIFTAYVSTFLPTDGNGDSSELTRHKVLKSLCSLAAEGMRHQRLLFEEEVLRK
HGLDGPSLTAFLNCIDYRAGLGIKKFYSFRHISFQEFFYAMSFLVKEDQSQQGEATHKEV
AKLVDPENHEEVTLSLQFLFDMLKTEGTLSLGLKFCFRIAPSVRQDLKHFKEQIEAIKYK
RSWDLEFSLYDSKIKKLTQGIQMKDVILNVQHLDEKKSDKKKSVSVTSSFSSGKVQSPFL
GNDKSTRKQKKASNGKSRGAEEPAPGVRNRRLASREKGHMEMNDKEDGGVEEQEDEEGQT
LKKDGEMIDKMNG
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggccttggcacgggccaacagcccccaggaggcactgctttgggccttgaatgacctt
gaggagaacagtttcaagacgctgaagttccacttacgagatgtgacccaatttcatctg
gcccgaggggaactggagagtctgagtcaggtggacctggcatcaaaactgatttcaatg
tacggagcacaggaagccgtgagagtggtgagcaggagcttgctggccatgaacttgatg
gagcttgtagactacctcaaccaggtttgtctgaatgattacagagaaatctaccgggag
catgtgcgctgcttggaggagaggcaagattggggtgttaatagcagccacaataagctg
ctcctgatggccacatccagttcagggggtcgcagatcaccttcctgttctgacctggaa
caggagttggatcctgtcgatgtggagactttatttgctccggaggcggagtcctactca
accccgcccatagtggtgatgcaaggatctgcgggcactggaaagacaaccctggtcaaa
aaactggtgcaggactggtccaaagggaagctgtacccaggccagtttgattatgttttc
tacgtgagctgcagagaagtggtcctgttacccaagtgtgacctgcccaacctcatctgc
tggtgttgtggagatgatcaagccccagtcacagagattctgcggcagcctgggcggctc
ctgttcatcctggatggctatgatgagttacagaagtccagtcgtgccgagtgcgtactt
cacattctgatgaggagaagggaggtaccatgctcccttctcatcaccacgcggcctcca
gctttgcagagtctggaacccatgttgggtgaacggcgacatgtccttgtcttaggcttc
tctgaggaggagagggaaacatatttcagctcctgttttacggataaggagcaattgaaa
aatgcccttgagtttgtgcaaaacaatgctgttctctataaagcatgccaggttccaggc
atttgctgggtggtctgctcctggctgaagaagaagatggcgagaggtcaggaagtctca
gagacacctagcaacagtacagacatcttcactgcttatgtgtccacctttctgcccact
gatggcaatggagacagctctgagcttaccaggcacaaggtactgaagagtctgtgctcc
ttggctgcggaggggatgcggcaccagaggctgctatttgaagaagaggtcctcagaaag
catggcttagacggccccagccttactgctttcctgaactgcatcgactaccgagcgggg
cttggcatcaagaaattctacagctttcgccacatcagcttccaggaatttttctatgcc
atgtccttccttgtgaaggaggaccagagtcagcagggagaggccacacacaaagaagtg
gcaaagctggtggatccagagaaccatgaagaggtgactctcagtttgcagttcttattc
gacatgttgaaaacagagggcaccttgagcttggggctgaagttctgcttcagaatcgct
ccttcggtaaggcaggatctgaagcattttaaagagcaaatagaagccataaagtacaaa
aggtcatgggatctggaattctctctctatgattctaagataaagaagctcacacaaggt
atccagatgaaagatgtcattctcaatgtgcaacatttggatgaaaagaaatctgacaag
aagaagtcagtttcagtgacaagcagctttagtagcgggaaggtacaaagtccattcttg
ggaaatgataaaagcaccaggaaacaaaagaaggcatctaatgggaaaagcagaggggca
gaggaaccagccccgggggttagaaaccgtaggctggcaagcagagaaaagggtcatatg
gagatgaatgataaggaggatggtggggtggaggaacaggaggatgaggaaggacagaca
cttaaaaaggatggagagatgatagataagatgaatgggtag

DBGET integrated database retrieval system