KEGG   Mus musculus (mouse): 244238
Entry
244238            CDS       T01002                                 

Gene name
Mrgpre, C130069N09Rik, Ebrt3, Mgrf, MrgE
Definition
(RefSeq) MAS-related GPR, member E
  KO
K08393  Mas-related G protein-coupled receptor member E
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    244238 (Mrgpre)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Mas proto-oncogene and Mas-related (MRGs)
    244238 (Mrgpre)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 244238
NCBI-ProteinID: NP_780743
MGI: 2441884
Ensembl: ENSMUSG00000048965
Vega: OTTMUSG00000060034
UniProt: Q91ZB7 Q4V9R2
Position
7; 7 F5
AA seq 310 aa
MTSLSVHTDSPSTQGEMAFNLTILSLTELLSLGGLLGNGVALWLLNQNVYRNPFSIYLLD
VACADLIFLCCHMVAIIPELLQDQLNFPEFVHISLTMLRFFCYIVGLSLLAAISTEQCLA
TLFPAWYLCRRPRYLTTCVCALIWVLCLLLDLLLSGACTQFFGAPSYHLCDMLWLVVAVL
LAALCCTMCVTSLLLLLRVERGPERHQPRGFPTLVLLAVLLFLFCGLPFGIFWLSKNLSW
HIPLYFYHFSFFMASVHSAAKPAIYFFLGSTPGQRFREPLRLVLQRALGDEAELGAGREA
SQGGLVDMTV
NT seq 933 nt   +upstreamnt  +downstreamnt
atgacgtccctgagcgtgcacacagattctcccagcacccagggagaaatggctttcaac
ctgaccatcctgtccctcacagagctcctcagcctgggcgggctgctgggcaatggagtg
gccctctggctgctcaaccaaaatgtctacaggaaccccttctccatctatctcttggat
gtggcctgcgccgacctcatcttcctctgctgccacatggtggccatcatccctgagctg
ctgcaggaccagctgaacttccctgaatttgtacatatcagcctgaccatgctgcggttc
ttctgctacattgtgggcctgagcctcctggcggccatcagcacggagcagtgcctggcc
actctcttccctgcctggtacctgtgccgccgcccacgctacctgaccacctgtgtgtgt
gcgctcatctgggtgctctgcctgctactggacctgctgctgagcggcgcctgcacccag
ttctttggagcacccagctaccacctgtgtgacatgctgtggctggtggtggcagttctc
ctggctgccctgtgctgcaccatgtgtgtgaccagcctgctcctgctgctgcgggtggag
cgtggtccagagagacaccagcctcggggcttccccaccctggtcctgctggccgtcctg
ctcttcctcttctgcggcctgccctttggcatcttctggctgtccaagaacctgtcctgg
cacatccccctctacttctatcatttcagcttcttcatggccagtgtgcacagtgcagcc
aagcctgccatctactttttcttgggcagcacacctggccagaggtttcgggaacccctc
cggctggtgctccagcgggcacttggagatgaggctgagctgggagctgggagagaggct
tcccaagggggacttgtggacatgactgtctaa

DBGET integrated database retrieval system