KEGG   Mus musculus (mouse): 244310
Entry
244310            CDS       T01002                                 

Gene name
Dlgap2, 6430596N04Rik, DA, Dap-2, Dap2, S, Sapap2
Definition
(RefSeq) DLG associated protein 2
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: GKAP Pollen_allerg_2
Other DBs
NCBI-GeneID: 244310
NCBI-ProteinID: NP_766498
MGI: 2443181
Ensembl: ENSMUSG00000047495
Vega: OTTMUSG00000034008
UniProt: Q8BJ42 Q0VF59 Q3V2X4
Position
8; 8 A1.1
AA seq 1059 aa
MGTAQVLPGILQKHCCILPDRNTESQCTLCGEPEEEEGGDLAQPGLSFPGPAEEDIDQQY
SWSPTQHFNEERYSPAPRNMKGLTGSRNQPQLCAGHTCGLSPPDDCEHPHDHMHHGSDVR
QPYLLSPAESCPMDHHRCSPRSSVHSECMMMPVMLGDHVSSSTFPRMHYSSHYDTRDDCA
MSHTSTKVNRIPANLLDQFEKQLPLHRDGFHTLQYQRASAATEQRNESPGRIRHLVHSVQ
KLFTKSHSLEGSSKSNINGTKSDSRVDDHHQSHLSKHSKRSKSKERKPESKHKSGMSSWW
SSDDNLDSDSTYRTPSVAHRHHMDHIPHCYPEALQSPFGDLSLKTSKSNNDVKCSACEGL
ALTPDTRYMKRSSWSTLTVSQAKEAYRKSSLNLDKPLVHPEIKPSLRPCHYLQVPQDDWG
AYPTGGKEEEIPCRRMRSGSYIKAMGDEESGESDSSPKTSPTVAIRPEPLLKPIIQRPLG
DHQTQSYLQAATEVPVGHSLNPSINYNSPKFRSRNQSYMRAVSTLSQASCVSQMSEAEVN
GQFESVCESVFSEVESQAMDALDLPGCFRTRSHSYLRAIQAGYSQDDECIPVMTSSNMTS
TIRSTAAVSYTNYKKTPPPVPPRTTSKPLISVTAQSSTESTQDAYQDSRAQRMSPWPQDS
RGGLYNSMDSLDSNKAMNLALETAAAQRHAADTQSSSTRSIDKAVLASKAEELLKSRCSS
IGVQDSEFPDHQPYPRSDVETATDSDTESRGLREYHSVGVQVEDEKRHGRFKRSNSVTAA
VQADLELEGFPGHVSMEDKGLQFGSSFQRHSEPSTPTQYGALRTVRTQGLFSYREDYRTQ
VDTSTLPPPDPWLEPSLDTVETGRMSPCRRDGSWFLKLLHTETKRMEGWCKEMEREAEEN
DLLEDILGKIRSAVGSAQLLMSQKFQQFYWLCQQNMDPSAMPRPTSQDLAGYWDMLQLSV
EDVSMKFDELHQLKLNDWKIIESPERKEERKIPPPIPKKPPKGKFPITREKSLDLPDRQR
QEARRRLMAAKRAASFRQNSATERADSIEIYIPEAQTRL
NT seq 3180 nt   +upstreamnt  +downstreamnt
atggggacggctcaggttctgcccggcatcctgcagaagcattgctgcatcttaccagac
aggaacacagagtctcagtgcaccctttgtggagagccagaagaggaggaaggaggagac
ttggcccagccgggcctcagcttcccgggtccagcagaagaggacatagaccagcagtac
tcatggtctccaacgcagcacttcaatgaagagaggtactcacccgcacccaggaacatg
aaagggttaaccggaagccggaaccagcctcagctgtgtgcgggtcacacctgtggcctg
tcaccccctgatgactgcgagcacccccatgatcacatgcatcatgggtcagatgtgcgg
cagccttatctccttagcccagctgagagctgcccaatggaccaccaccgttgctcgccc
aggagctccgtccactcagagtgcatgatgatgcctgtgatgttgggtgaccacgtatcc
agtagcaccttccctagaatgcactacagctcacactatgacacaagggatgattgcgcc
atgtcccacacaagtacaaaggtaaaccgcatccccgccaacctcttagaccagtttgag
aaacagctccccctgcaccgggatggtttccacacactgcagtaccagagggcctcggct
gccacggaacagcggaatgagagtccaggcagaatccggcatttggtccactccgttcag
aaacttttcaccaagtctcattctttggagggatcgtccaagagcaacatcaatgggacc
aagagtgacagtcgtgtggatgaccaccaccagagtcacctttccaaacacagcaaaagg
agtaaaagcaaggagcggaagccagagagcaagcacaagtctggtatgagcagctggtgg
agttctgacgacaacctggacagtgacagcacataccggacacccagcgtggcgcaccgc
caccacatggaccacattccccactgctaccctgaggcgctgcagagcccatttggggac
ctctcactaaagacttccaaaagcaacaacgatgttaagtgctcagcctgtgaaggcttg
gccctcacgccagacaccaggtacatgaaacgtagctcctggtccacgctcacggtgagc
caggctaaggaggcctaccgcaagagctccctgaacttggacaagcccctggtccaccca
gagatcaagccttccctgcggccatgccactacctccaggtgcctcaggacgattggggt
gcgtaccccacaggcggcaaagaggaggagataccctgccgtaggatgaggagcggcagc
tacataaaagccatgggtgacgaggagagtggggagtcagactccagccccaaaacatcc
ccgacggtggccatccggccggagccgctgctgaagcccatcatacaaagaccacttgga
gaccaccaaacccagagctacctacaagctgccactgaggtgcctgtcggtcacagcctg
aacccatcaatcaactacaactctccgaagttccggtccagaaaccagagctacatgcgg
gctgtgagcaccctgagccaggccagctgtgtgagccagatgagtgaagcggaagttaac
gggcagttcgagtctgtatgtgaatctgtcttcagtgaagttgaatctcaggccatggat
gctcttgaccttcctgggtgtttccgaacaaggagtcacagttaccttcgagccatccaa
gctggttactcccaagacgatgaatgtattcccgtgatgacatcatccaacatgacgtca
accatcaggtcaacagcagctgtctcctacacaaattacaagaagacgcctcccccggtg
cctccacggaccacctccaagcctctgatctctgtgacggcccagagcagcacggaatcg
acacaggatgcctaccaggacagccgtgcccagaggatgtccccctggccccaagatagc
cgtggcggcctctacaactccatggacagtctagacagcaacaaggccatgaatttggct
ctggaaacagctgcagcccagcgccacgcggcggacacccagagcagctccacacggagc
atcgacaaggcggtcctggcatccaaggctgaagagctcctgaaaagtcgctgctcctcc
atcggggtccaggattctgaattccccgatcatcaaccctacccaaggtcagatgtagaa
acagccacggattccgacacggagagcagaggcctaagggagtaccactctgttggtgtg
caagtagaagacgaaaaacggcacggccgtttcaagcgttccaacagcgtcacagccgct
gtgcaggctgacttagagctggagggtttccctgggcatgtcagcatggaggacaagggc
ctgcagttcggatcctccttccaacgacattcggagcccagtaccccgacccagtatggg
gcactgaggactgtgcggacgcagggcctcttcagttacagggaggactacaggacacag
gtggacacttctactctgccaccaccggatccctggctggagccatccctggacacggtg
gagaccgggaggatgtctccgtgccggagagatggctcgtggtttctgaaactgctgcac
acggagacgaagaggatggaaggctggtgcaaagagatggagagagaagcagaggagaat
gacctcttggaagacattctaggaaagatcaggagtgctgtaggaagtgctcagctgctc
atgtcccagaagttccagcagttttactggctttgtcagcagaacatggaccccagcgcc
atgccaagacccacctcacaggatctagctggctattgggatatgctgcagctgtctgtg
gaagatgtcagcatgaagtttgacgagctgcaccagctgaagctcaatgactggaagata
atagagtcacccgaaagaaaggaagaaaggaagatcccccctccaataccaaagaagccc
cccaaggggaaattccccatcacgagggaaaagtccttggacctgccagacagacagcgc
caggaagcccggcgccggctcatggcagccaagagagccgcctcgttccgccagaactct
gctacggagagggcagacagcatcgagatctacatccctgaggcccagacgcggctctga

DBGET integrated database retrieval system