KEGG   Mus musculus (mouse): 244551
Entry
244551            CDS       T01002                                 

Symbol
Nanos3, nos3
Name
(RefSeq) nanos C2HC-type zinc finger 3
  KO
K18761  protein nanos 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    244551 (Nanos3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     244551 (Nanos3)
SSDB
Motif
Pfam: zf-nanos A2L_zn_ribbon
Other DBs
NCBI-GeneID: 244551
NCBI-ProteinID: NP_918948
MGI: 2675387
Ensembl: ENSMUSG00000056155
Vega: OTTMUSG00000061277
UniProt: P60324
Position
8; 8 C2
AA seq 178 aa
MGTFNLWTDYLGLARLVGALHKEEELDVRLDPKPEPKPSSESQQASKESSAAPERLCSFC
KHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATQEHAHTRRFCPLTSQGYTSVYC
YTTRNSAGKKLTRPDKAKTQDAGHRLGGEAAAGVYAGSKSGRKPPGPSPSACCPSTTA
NT seq 537 nt   +upstreamnt  +downstreamnt
atggggactttcaatctttggacagattacctaggtctggcaagactggttggggctctg
cataaggaagaggagcttgatgtaaggctggatcccaaaccagagcccaagccaagttca
gaaagccagcaagccagcaaggaatcctctgcagctcctgaacgcttatgttcattctgc
aaacacaatggcgagtcccgtgccatctatcagtcccatgtcctgaaggatgaggcaggg
cgggtgctgtgtcccattttgcgggattatgtgtgtccccagtgtggggccactcaggag
catgcccacactcgacgcttttgcccactcaccagccagggctacacttctgtctactgc
tacaccacccggaattctgcaggcaaaaagctgacccggcctgacaaggcaaagacacag
gatgctggccaccgccttggaggagaagcagcagcaggtgtctatgcaggttccaaaagt
ggcaggaagccccctggaccttcaccctcggcctgctgtccctccactacggcctag

DBGET integrated database retrieval system