KEGG   Mus musculus (house mouse): 244585
Entry
244585            CDS       T01002                                 
Symbol
Rpgrip1l, 1700047E16Rik, 4931437C01, Ftm, Nphp8
Name
(RefSeq) Rpgrip1-like
  KO
K16550  protein fantom
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    244585 (Rpgrip1l)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    244585 (Rpgrip1l)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     244585 (Rpgrip1l)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  MKS complex
   244585 (Rpgrip1l)
SSDB
Motif
Pfam: C2-C2_1 RPGR1_C C2
Other DBs
NCBI-GeneID: 244585
NCBI-ProteinID: NP_775607
MGI: 1920563
Ensembl: ENSMUSG00000033282
UniProt: Q8CG73
Position
8:complement(91943658..92039919)
AA seq 1264 aa
MSGPSDETAGDLPVKDTGLNLFGVGGLQETSTARTVKTRQAVSRVSREELEDRFLRLHDE
NILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVH
ELERQNEVLKNRLISAKQQLQVQGHRQTSYSRVQARVNTGRRRASASAGSQECPGKGLRF
QNVDEAETVQPTLTKYSNSLLEEARGEIRNLENVIQSQRGQIEELEHLAEILKTQLKRKE
NEIELSLLQLREQQATDQRSNIRDNVETIKLHKQLVEKSNALSVIEGKFIQLQEKQRTLR
ISHDALMANGDELNKQLKEQRLKCCSLEKQLHSVRFSERRVEELQDRINDLEKERELLKE
NYDKLYNSAFSAAHEEQWKLKEQQMKVQIAQLETALKSDLTDKTEVLDKLKTERDQNEKL
VQENRDLQLQCLQQKQRLHELQSRLKFFNQESDINADDLSEALLLIKAQKEQKNGDLSFL
EKVDSKINKDLDRSMKELQATHAETVQELEKTRNMLIMQHKINKDYQMEVETVTQKMENL
QQDYELKVEQYVHLLDIRAARIQKLEAQLKDIAYGTKQYKFKPEIMPDDSVDEFDETIHL
ERGENLFEIHINKVTFSSEVLRASGDKELVTFCTYAFYDFELQTTPIVRGLYPEYNFTSQ
YLVHVNDLFLQYIQKNTVTLELHQAHSTDYETIAACQLRFHEILEKSGRIFCTTSLVGTK
GDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKKPEKMQLSSQQAATTAQIS
PAESTDGNLNELHVTVKCCTGLQSRASYLQPHAYVVYKFFDFPDHDTAIVPSSNDPQFDD
HMCFPVPMNMDLDRYLKSESLSFYVFDDSDTQENIYMGKVNVPLISLAHDKCISGIFELM
DKEKHAAGTIQVILKWKFTYLPPSGSITTEDLGKFVCREEPEAVQRLPPKSSDVTSVVAP
KPKPRQRLTFVDKKVSFADTISHPSPETSPPPKDIKDSSPEVGPKPENGLSAVAYPSKES
GVAKVEENVGEMQQGKEDDISFLSEGQLASGSVASSEDETEITEELEPEDEDRSASDSDD
CIIPSSVSTNTKQPSEEIRIEIIALNLNDSQITREDTIQRLFIECRFYSLPAEETPMSLP
KPQSGQWVYYNYSNVIYLDKENNPAVRDILKAILQRRELPHRSVRFTVVSDPPEDEQDLE
CEDIGVAHVDLADLFQKGRDIIEQDIDVLDARTDGGTIGKLKVTVEALHALRSVYEQNRK
DLEA
NT seq 3795 nt   +upstreamnt  +downstreamnt
atgtctggcccaagtgacgagacagcaggagacctgccggtgaaagatacaggtctaaac
ctctttggagttggagggttacaagaaacctcaactgcacgcacagtgaagactcgccag
gcagtgtcacgtgtcagtcgtgaagaactggaagacagatttttgcgtttgcatgatgag
aacattttacttaaacagcatgcccgcaagcaagaggataaaattaaaagaatggccacc
aagttaatacggctagttaatgacaagaaaagatatgagcgggttggtggcggccccaag
cggctgggacgagatgtggaaatggaagaaatgattgagcagctgcaagaaaaagttcat
gagcttgaaagacaaaatgaagttctcaaaaacaggctgatatcagccaaacagcagctc
caagtccagggacacaggcagacgtcgtacagtcgagtgcaggctcgagttaacaccggc
cgccggagagcaagtgccagtgcaggctcgcaggaatgccctgggaaaggtctaagattt
caaaatgtggatgaagcagaaactgtacaacccacgctcacaaaatacagcaatagttta
cttgaagaagccagaggagaaataagaaatttggaaaatgttattcagtcacagagaggc
cagatagaagagttagagcacttggcagagatcctgaaaactcagttgaagagaaaagaa
aatgaaatcgagctatctcttcttcagcttcgagaacagcaggctacagatcagaggtca
aatattcgggacaatgtagaaacgattaagcttcataaacaactagtggagaaaagcaat
gctctttcagtcatagaaggaaaatttattcagcttcaagagaagcaaagaacactcagg
atcagccatgatgccttgatggccaatggagatgagctgaacaagcagcttaaggagcag
cgtctgaagtgctgcagccttgagaagcagctgcactcggtgaggttttcagaaaggaga
gtagaggagctgcaggatagaattaatgatttagaaaaggagcgggaactattaaaggaa
aactatgataaactttataacagcgccttcagtgctgcccatgaagagcagtggaagtta
aaggagcagcagatgaaagtgcagattgctcagctcgaaactgccttaaaatctgatctt
acagacaaaaccgaagtccttgacaaactaaagactgaaagagaccaaaatgagaaactg
gttcaagagaatagagatctacagctgcagtgtctgcagcaaaagcagcggctgcatgag
cttcagagccgcctgaagttcttcaaccaggagagtgacatcaatgctgatgacctcagt
gaagcactcctgcttataaaggctcaaaaagaacaaaaaaatggagatctttcattttta
gaaaaagtggacagcaaaatcaataaagatctagaccgatccatgaaagagcttcaagca
actcatgcagaaacagtacaagaacttgaaaagacaagaaatatgttaattatgcaacat
aaaataaataaagactatcagatggaagttgaaacagtgactcagaaaatggaaaatttg
caacaagattatgaactcaaagtggaacaatatgttcatcttctcgatatcagggctgca
cgcatccaaaagcttgaagcccagttaaaggatattgcctatggcactaagcagtacaaa
tttaaaccagaaatcatgccagatgactcagttgatgaatttgatgaaaccatccaccta
gaacgaggagaaaatctctttgaaatccacatcaacaaagtcaccttttcttctgaagtc
cttcgggcatctggtgataaagaacttgtcactttctgtacctacgctttctatgacttt
gaactgcagactactcccatagtgcgaggcctttacccggagtataacttcacttctcag
tatctggtccacgtcaatgacttatttttgcagtacattcagaagaacactgtcacgctg
gagctccaccaagcccacagcacagattacgaaacaattgcagcgtgtcagttgagattc
catgagattctagaaaaaagtggtagaattttttgcacaacaagcttagttggaactaaa
ggagacatcccaaattttggcacagtagaatactggttccgattaagagttcccatggat
caagctattcgactttatcgtgagcgggcaaaggcattaggatacataacatcaaatttt
aagaagccagagaaaatgcaattgtcgagtcagcaagcagccacaactgctcagatcagc
ccagcagagtccacagacggcaacttgaatgaacttcatgttacagtaaaatgctgcacc
ggcctccagtcccgagcgagctacctgcagccacacgcatatgtggtatacaagtttttt
gattttccagaccatgataccgccatcgttcccagtagcaatgacccacagtttgatgac
cacatgtgtttcccagtgccgatgaatatggatttggatcgctaccttaagtcagagtct
ctgagtttctatgtttttgatgatagtgatacccaggagaatatttacatgggaaaagtc
aatgtgcctctgatttccctggcacatgacaagtgtatctcaggaatatttgagttgatg
gataaggaaaagcatgctgcaggaactatccaagttatattgaaatggaaattcacctac
cttccaccaagtggatcaataactactgaagaccttggaaagttcgtttgcagagaagaa
ccagaggctgttcagagactacctccaaagtcctcagatgttacatcagttgtagcacca
aaacctaaaccaagacaacgtttaacatttgtggacaaaaaggtctcttttgcagatacc
atatcacacccgagtcccgagacttctcctccccctaaagatataaaagacagttctcca
gaagtgggaccaaaaccagaaaatggtctgtcagctgttgcgtatccttccaaggaaagc
ggtgtggctaaggtagaagaaaatgtgggggaaatgcaacaagggaaagaagacgacatc
tctttcttatctgagggccagcttgcctcaggaagtgtggcttcctctgaagatgaaaca
gaaataactgaagaattggaaccagaagatgaagacagatcagcttcagacagtgatgac
tgtatcattccaagttctgtctccacaaataccaaacagccatcagaagaaattcggatt
gagatcatagctctgaaccttaatgattctcaaataaccagggaggatactattcagcga
ctcttcattgagtgccggttctacagtcttcccgctgaggagactcctatgtccctgccc
aaaccccagagtggacagtgggtctactataactattccaatgtgatctacctggataaa
gaaaacaacccagcggtgagagacatcttaaaagccatactgcaaaggcgagaactgcct
cacagaagtgtgcgcttcaccgtggtcagtgatcctcccgaggacgagcaggacctagaa
tgtgaggacattggggttgcccatgttgaccttgctgacctgtttcagaaaggaagagac
atcatagagcaagatattgatgttctcgatgcccgaacagacggtggcaccatcggcaaa
ctgaaggtgactgtggaagcacttcatgccctacggtctgtctacgagcaaaatagaaag
gacttggaggcctga

DBGET integrated database retrieval system