KEGG   Mus musculus (house mouse): 244608
Entry
244608            CDS       T01002                                 
Symbol
Ccdc113, 4933409I22
Name
(RefSeq) coiled-coil domain containing 113
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF4201 DUF745 Flavodoxin_5
Other DBs
NCBI-GeneID: 244608
NCBI-ProteinID: NP_766502
MGI: 3606076
Ensembl: ENSMUSG00000036598
UniProt: Q8C5T8
Position
8:96260684..96285516
AA seq 377 aa
MSEEDSDSVITDSQAEEEGELPVIQLCGLVEELSYGNSALKTETEMFEKYYSRLEPRDHR
MTRLSDIKITAAEFSQLRSRRKSKARGGLDRTLGLTVEQKLELVQKELEDTRDEIRHMRA
NAERDLQHHEAIIEEADIRWNEVQKAVHEFEKDILKTISKKKGSILATQKVMKYIEDMNR
RRDNIKDKLCLKNVSLKVQRKKMLSQLRQKEEVGEALHDVDFQQLKIENAQFLETIEARN
KELIQLKLASGNTLQVLNTYKNKLHRAMEIYVNLDKEILLRNELLGKIEKETIQAEEDRA
KAHILNDKLRKQLAEFRAPQVMMYVKEKILNGELEKTIKMWERKVEIAEMSLKGYRKAWN
KMKTSDEQLQIIRPPGK
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtctgaggaagactcggacagcgtgatcactgactcccaggcggaggaggaaggcgag
ctgccagtcatccaactgtgcgggctggtagaggagctcagctatggaaactctgctctc
aaaacagaaacagagatgttcgagaaatattactctagactggaacccagggaccaccga
atgacacggttgtcagatattaaaataacagcagcagaattttcacagttacgatccagg
cgtaaatccaaggcccgtggaggtctggaccgtacgctaggcctcactgtagagcaaaag
ctcgagcttgtgcagaaggagctggaagacacgagagatgaaatacggcacatgcgggct
aatgcggaacgggacctgcagcatcacgaggctatcatcgaggaagccgacattcggtgg
aatgaagttcagaaagcagtgcacgaatttgaaaaagatattctgaaaaccatatccaag
aagaaagggagcattttggccactcagaaagtgatgaaatacatcgaggacatgaaccgc
cgcagggataatataaaggataaattgtgtttgaaaaatgtttctctcaaagttcaaagg
aaaaagatgctttcacaattgagacagaaggaggaggtaggcgaggccctgcacgacgtg
gactttcagcagctgaaaatcgagaacgctcagtttttggagacgattgaagcaaggaac
aaagaactgatccagctgaagctggcctctgggaacacgctgcaggttctcaacacctac
aaaaacaagcttcatcgggcaatggagatctacgtcaatctggacaaggagatcttgctg
agaaacgagctacttgggaaaattgaaaaagaaaccatacaagcagaggaggacagggcc
aaagcccatatcttgaacgataagttacggaagcagctggctgagttccgggccccacag
gtaatgatgtacgtcaaggagaagatcctgaatggggagctagagaagaccatcaagatg
tgggagcggaaggtggagatcgcagagatgtctctaaaagggtaccggaaggcctggaat
aagatgaagacttcggatgagcagttgcagataatccggccccctgggaaatag

DBGET integrated database retrieval system