KEGG   Mus musculus (mouse): 244631
Entry
244631            CDS       T01002                                 

Gene name
Pskh1, AW539964, E130013P03Rik, b2b1230Clo
Definition
(RefSeq) protein serine kinase H1
  KO
K08808  protein serine kinase H [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    244631 (Pskh1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     244631 (Pskh1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  PSK family
   244631 (Pskh1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like Pkinase_fungal FTA2 Cytokin-bind
Other DBs
NCBI-GeneID: 244631
NCBI-ProteinID: NP_775608
MGI: 3528383
Ensembl: ENSMUSG00000048310
Vega: OTTMUSG00000029308
UniProt: Q91YA2
Position
8; 8 D3
AA seq 424 aa
MGCGTSKVLPEPPKDVQLDLVKKVEPFSGTKNDVYKHFITEVDSVGPLKAGFPATSQYAP
PCPGVPNTGHTAPPSEPPRRARVAKYRAKFDPRVTAKYDIKALIGRGSFSRVVRVEHRAT
RQPYAIKMIETKYREGREVCESELRVLRRVRHANIIQLVEVFETQERVYMVMELATGGEL
FDRIIAKGSFTERDATRVLQMVLDGVRYLHALGITHRDLKPENLLYYHPGTDSKIIITDF
GLASARKKGDDCLMKTTCGTPEYIAPEVLVRKPYTNSVDMWALGVIAYILLSGTMPFEDD
NRTRLYRQILRGKYSYLGEPWPSVSNLAKDFIDRLLTVDPGARMTALQALRHPWVVSMAA
SSSMKNLHRSISQNLLKRASSRCQSTKSSQSTRSSRSTRSNKSRRVRERELRELNLRYQQ
QYNG
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgggctgtgggacaagcaaggtccttcctgagccacccaaggatgtccagctggatctg
gtcaagaaagtggagcccttcagtggcactaagaatgatgtatacaagcacttcatcaca
gaggtggacagtgttggccctctcaaagctggcttcccagctactagtcagtatgcacct
ccctgccctggtgttcccaatactggccacacagcgcctccttcagaaccaccacgaagg
gccagggtggcaaagtacagggccaaatttgacccacgagtgacagctaagtatgatata
aaggccctaattgggcgaggcagctttagccgagtggtacgtgtggagcaccgggcaacc
cgacagccatatgctatcaagatgatagagaccaagtaccgagaagggcgggaggtgtgt
gagtccgagctccgagtgctgcgccgggtgcgccacgccaacatcatccagctggtagaa
gtgtttgagacacaggagcgtgtatatatggtgatggagctggccactggcggtgagctc
tttgaccggattattgccaagggttctttcactgaacgagatgccacaagagtgcttcaa
atggtactggatggtgtccggtatcttcatgcccttggcattacacaccgagacctcaag
cctgagaatctcctttactaccacccaggcactgactccaagatcatcatcactgacttt
ggcttggccagtgcccggaagaaaggtgacgactgcctgatgaagaccacgtgcggcaca
cctgagtacattgctcctgaggttctggtgcgaaaaccctacaccaattccgtggatatg
tgggcactgggtgtcattgcctacatcctgctcagcggcaccatgccctttgaggatgac
aaccgcacccggctataccggcagatcctcaggggcaaatacagttatctgggggagccc
tggcctagtgtatctaatctggccaaggacttcattgaccgcctgctgaccgtggaccct
ggagcccggatgactgcactgcaggccctaagacacccatgggtagtaagcatggcagcc
tcttcatccatgaagaatctgcaccgatccatctcccagaatctcctcaagcgggcttcc
tctcgttgccagagcaccaagtcttcccagtccacgcgttccagccgctccactcgttcc
aacaagtcacgccgtgttcgggagcgcgaactgcgggagcttaacctgcgctatcaacag
cagtataacggctga

DBGET integrated database retrieval system