KEGG   Mus musculus (mouse): 244650
Entry
244650            CDS       T01002                                 

Gene name
Phlpp2, AI481772, C130044A18Rik, P, Phlppl
Definition
(RefSeq) PH domain and leucine rich repeat protein phosphatase 2
  KO
K16340  PH domain and leucine-rich repeat-containing protein phosphatase [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    244650 (Phlpp2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    244650 (Phlpp2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     244650 (Phlpp2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    244650 (Phlpp2)
SSDB
Motif
Pfam: LRR_8 LRR_4 PP2C LRR_6 PH
Other DBs
NCBI-GeneID: 244650
NCBI-ProteinID: NP_001116066
MGI: 2444928
Ensembl: ENSMUSG00000031732
Vega: OTTMUSG00000034048
UniProt: Q8BXA7 J3QM82
Position
8; 8 D3
AA seq 1355 aa
MGEVEPVPAGPLEPPEPPEAAAPRRPGGIRVLKRNMKHNGSRTCLNRRSRFGSRERDWLR
EDVKRGCVYLYGADTTTATTTTSSSSSSSSSSDLHLVLCTVETPASEICAGEGRESLYLQ
LHGDLVRRLEPSERPLQIVYDYLSRLGFEDPVRIQEEATNPDLSCMIRFYGEKPCQMDHL
DRILLSGIYNVRKGKTQLHKWAERLVVLCGTCLIVSSVKDCQTGKMHILPLVGGKIEEVK
RRQHSLAFSSAGAQAQTYHVSFETLAEYQRWQRQASKVVSQRMSTVDLSCYSLEEVPEHL
FYSQDITYLNLRHNFMQLERPGGLDTLHKFSQLKGLNLSHNKLGLFPVLLCEISTLTELS
LSCNGFHDLPSQIGKLLNLQTLSLDGNGLTALPDELGNLRQLTSLGISFNDFRHIPEVLE
KLTMLDKVAMAGNRLEVLNLGALTRMSQVKHVDLRMNHLKTVITENMEGNKHITHMDLRD
NQLTDLDLSSLCSLEQLHCERNQLRELTLSGFSLRTLYASWNRLTAVNVYPVPSLLTSLE
LSQNLLECVPDWACEAKKLEILDISHNLLTEVPMRILSSLSLRKLMVGHNHIHVLPALVE
HIPLEVLDIQHNTLSRLPDTLFSKALNLRYLNASANSLESLPSACAGEESLSVLQLLYLT
SNLLTDQCIPVLVGHPHLRVLHLANNQLQTFPASKLNKLEQLEELNLSGNKLTAIPTTIA
NCKRLHTLVAHANNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTGNTN
LVLEHKTLDMFSHITALKIDQKPLPATDSAVTSTFWSHGLAEMAGQRNKLCVSALAMDNF
AEGVGAVYGMFDGDRNEELPRLLQCTMADVLLEEVQHSTNDTVFMTNTFLVSHRKLGMAG
QKLGSSALLCYIRPDTADPTSSFSLTVANVGMCQAVLCRGGKPVPLSKVFSLEHDPEEAQ
RVKDQKAIITEDNKVNGVTCCTRLLGCTYLYPWILPKPHIASTPLTIQDELLILGNKALW
EHLSYLEAVNAVRHVQDPLAAAKKLCTLAQSYGCQDNVGAMVVYLNIGEEGCTCEMNGLT
LPGPVGFASTAALKDTPKPTTPSSSSGIASEFSSEMSTSEVSSEVGSTASDEHNTVGLEA
SLLPRPERRCSLHPASSAGVFQRQPSCATFSSNQSDNGLDSDDDQPVEGVITNGSRVEVE
VDIHCCRGREPESSPPLPKNSSNACSEERARGAGFGIRRQNSVNSGILLPANRDKMELQK
SPSTSCLYGKKLSNGSIVPLEDSLNLIEVATEAPKRKTGYFAAPTQLEPEDQFVVPRDLE
EEVKEQMKQHQEGRPEPEPRGEERTEPLEEFDTAL
NT seq 4068 nt   +upstreamnt  +downstreamnt
atgggggaggtggagcccgtgcccgcgggcccgctggagcccccggagccacctgaagcg
gcggcgcctcgccggcccggagggattcgggtcctaaagagaaatatgaaacacaatggg
agcagaacttgtttgaatagaagaagtaggtttggttcccgagaaagagactggctaaga
gaagatgtgaagagaggctgtgtttacctttatggagcagacacgaccactgccactaca
accacctcctcctcctcctcctcctcctcctcttctgatttacatcttgtcctttgcaca
gtagagacaccagcgtcagaaatatgtgctggagagggaagagaaagcctctatctacag
cttcatggagatctggtcaggagactggagccctctgaacggcctctccagattgtttac
gattacttatccaggctggggtttgaagatcccgtgcgcatacaggaggaggctacgaac
cctgacctcagctgtatgattcgattttatggtgaaaaaccatgccagatggatcatctg
gatcgaatcctactgtctggcatctataatgtacgcaaaggaaaaacccagctgcacaaa
tgggctgagcgcctcgttgttctctgtggtacctgccttattgtttcctcagtgaaggat
tgtcaaactggaaagatgcacattttgccgctggttgggggaaagatagaagaagtgaag
cgccggcagcactcccttgctttcagctcagctggagcccaagctcagacctatcatgtc
agctttgagactttggctgagtaccagagatggcaacggcaggcgtctaaggtggtgtcg
cagcggatgagcactgtggacctctcatgctacagccttgaagaggttcctgagcatctc
ttctacagccaagacatcacctacctcaacctgcggcacaacttcatgcagctagaaaga
ccagggggccttgacacactccacaaattttctcaactgaagggcctgaacttgtcccat
aataaacttggactgtttcctgtgctgctgtgtgagatttctaccctgactgagctcagc
ctttcttgtaatggatttcatgacttgccaagtcagattggtaaattgctaaatcttcag
accctcagcctcgacggcaacggcctcacggctctgccagatgagttgggaaacctgcgg
cagctcacttctctgggaatttccttcaacgattttcgtcacatccctgaagttttggag
aaacttaccatgttagataaagtggctatggcaggaaaccgtttggaggtcctgaacctg
ggggcactgaccaggatgagccaggtcaagcacgtggatctgaggatgaaccacttgaaa
acggtgattactgaaaatatggaaggaaataaacatatcacgcacatggatttgcgggac
aatcagttgactgatttggaccttagctccttatgtagcttggagcagctgcactgtgag
cggaaccagctgagggagctgacactcagcggcttctcccttcgaaccctctacgccagt
tggaacaggctgacggcagtgaatgtgtacccagtgcccagcctgctcacttctttggag
ctctcccaaaacttgctggagtgtgtccctgactgggcctgtgaagcaaaaaagctggaa
atactagacataagccacaatcttcttacagaggtccccatgagaattctgagtagtctg
agtcttcggaaactgatggtaggacacaatcacatccatgtccttcctgcactggtggag
cacattcccctcgaggtcctggatatccagcataacactctctccaggctgccggacacg
ctcttctccaaggccttaaatctcaggtacttgaatgcatctgcaaatagtctggagtcc
ttgccttctgcgtgtgctggagaggagagtctgagtgtgctgcagctgctgtacctgacc
agcaaccttctgacagatcagtgcataccagttttggtcgggcacccacacctgcgagtt
ctgcaccttgcaaacaaccagctccagaccttccctgcaagcaagctaaataaactggag
cagctggaagagctgaatctaagtgggaacaaacttacagctatccccacaaccatagcc
aactgcaaaaggctgcacacccttgtcgcccatgccaacaacatcagcatcttcccagag
atcctgcagctgcctcagattcagtttgtagacctgagttgcaatgacttgacagaaatc
ctaattccagaagctctgcctgctactttacaagaccttgatctgacaggaaatacaaat
ctggtcctggaacataagactttggacatgtttagccacatcacagccctgaagattgat
cagaagcctttgccagccacagactctgcagttacatcaaccttctggagccatggcctg
gccgagatggcagggcagaggaataaactctgtgtgtctgccctggctatggataacttt
gcagagggtgtgggagctgtctacggcatgtttgatggggaccggaatgaagaactccct
cgtctgctgcagtgtacaatggcagatgtgcttttggaagaagtacagcactcaacaaat
gacacagttttcatgaccaataccttcttggtatctcacaggaaattaggaatggctggc
cagaagctgggttcttcggctctcctgtgctatattcgacctgacactgccgacccaaca
agtagctttagcttgactgtagccaatgttggcatgtgccaagctgtcctgtgccgaggt
gggaagccagtacctctttctaaagtcttcagcttggagcatgacccagaggaggctcag
agggtgaaagaccagaaagccatcataacagaggacaacaaggtgaacggagtaacctgc
tgcacccggctgctggggtgcacatacctctacccatggatcctccccaagccccacata
gcttccactccacttaccattcaagatgaattgctgattttgggaaacaaagcactgtgg
gaacacttgtcatatctagaagctgtcaatgcagtacgtcacgtgcaagacccactagct
gctgctaagaagctgtgcacattagcccagagctacggttgtcaggacaacgtgggggca
atggtggtttatttgaatattggtgaagaaggctgtacctgtgaaatgaatgggctcacc
cttccaggccctgtgggatttgcttcaactgcagccctcaaggatactcccaagccaacc
actccctcctccagtagtgggattgcctccgagttcagcagtgagatgtccacctcagag
gtgagcagtgaagtgggctccacggcctcggatgagcacaacactgtgggcctggaggcg
agcttgctgcccaggccagagaggcgctgcagtctgcacccagcgtcctccgcaggggtg
ttccagcgccagccttcttgtgctactttttccagcaatcagtctgacaatggcctggac
agtgacgatgaccagcctgttgaaggagtcataaccaacggcagcagggttgaagtagag
gtagacatccattgctgccgaggcagagagccagagagctcccctccgctcccgaagaac
tcttccaacgcctgttcagaggagcgtgctagaggggcggggtttgggatccgaagacag
aacagtgtcaacagtggtatacttctgccagcgaacagagacaagatggagctgcagaag
tctccctccacttcttgtctgtatggaaagaaactctccaatggctccattgtgccccta
gaggacagcctgaacctcattgaggtggccacagaagcacccaaaaggaaaactggctac
tttgctgcccccactcagctggaaccagaggatcagtttgtcgtccctcgagacctggaa
gaggaagtgaaggagcagatgaagcagcaccaggagggcaggcctgagcccgagccccgg
ggagaggagcggacagagcccctggaggagtttgatacagcactgtga

KEGG   Mus musculus (mouse): 98432
Entry
98432             CDS       T01002                                 

Gene name
Phlpp1, AI836256, P, Phlpp, Plekh, Plekhe1, SCOP, mKIAA0606
Definition
(RefSeq) PH domain and leucine rich repeat protein phosphatase 1
  KO
K16340  PH domain and leucine-rich repeat-containing protein phosphatase [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    98432 (Phlpp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    98432 (Phlpp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     98432 (Phlpp1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    98432 (Phlpp1)
SSDB
Motif
Pfam: LRR_8 PP2C LRR_4 LRR_6 PH
Other DBs
NCBI-GeneID: 98432
NCBI-ProteinID: NP_598582
MGI: 2138327
Ensembl: ENSMUSG00000044340
Vega: OTTMUSG00000021548
UniProt: Q8CHE4
Position
1; 1 E2.1
AA seq 1687 aa
MEPAAAAPAQRLADPTGEDQALAAAAAEGGRCPDPALSAAAPSGGNGGAAREEAPCEAPP
GPLPGRAGGTGRRRRRGAPQPAAGGAAPVPAAGGGANSLLLKRGRLKRNLSAAAAASSSS
SPSSASSAAGGLPASCSASASLCTRSLDRKTLLLKHRQLLQLQPSDRDWVRHQLQRGCVH
VFDRHMASSYLRPVLCTLDTTAAEVAARLLQLGHKGGGVVKVLGYGPPPAAAPAASDQTL
DGEHGRDVEPPPSSGTVGAVRGPARAPPADLPLPGGAWTRCAPRISPAPSDSSPGELFAG
GPGSPPRAPRPASDTESFSLSPSAESVSDRLDPYSSGGGGSSSSSEELEADPAMPHRPGR
PAQPRPPSPKTSALLQPKAPTGVDSTGVIAGEGPGDDKAMAAAAPDVPLSTSGRIRETVQ
KTSPPSLYVQLHGETTRRLEADEKPLQIQNDYLFQLGFGELWRVQEEGMDSEIGCLIRFY
AGKPHSTGSSERIQLSGMYNVRKGKMQLPVNRWTRRQVILCGTCLIVSSVKDSVSGKMHV
LPLIGGKVEEVKKHQHCLAFSSSGPQSQTYYICFDTFTEYLRWLRQVSKVASQRISSVDL
SCCSLEHLPANLFYSQDLTHLNLKQNFLRQTPTLPAARGLGELQRFTKLKSLNLSNNHLG
AFPSAVCSIPTLAELNVSCNALREVPAAVGDMQNLQTFLLDGNFLQSLPAELESMHQLSY
LGLSFNEFTDIPEVLEKLTAVDKLCMAGNCVETLRLQALRRMPHIKHVDLRLNILRKLMA
DEVDFVQHVTQLDLRDNKLGDLDAMIFNNIEVLHCERNQLVTLNVCGYFLKALYASSNEL
AQLDVYPVPNYLSYMDVSRNCLESVPEWVCESRKLEVLDIGHNQICELPARLFCNSSLRK
LLAGHNRLARLPERLERTSVEVLDVQHNQITELPPNLLMKADSLRFLNASANKLETLPPA
TLSEETSSILQELYLTNNCLTDKCVPLLTGHPRLKILHMAYNRLQSFPASKMAKLEELEE
IDISGNKLKAIPTTIMNCRRMHTVIAHSNCIEVFPEVMQLPEVKCVDLSCNELSEITLPE
NLPPKLQELDLTGNPRLALDHKSLELLNNIRCFKIDQPSAGDASGAPAVWSHGYTEASGV
KNKLCVAALSVNNFRDNREALYGVFDGDRNVEVPYLLQCTMSDILAEELQKTKNEEEYMV
NTFIVMQRKLGTAGQKLGGAAVLCHIKPDPVDLGGSFTLTSANVGKCQTVLCRNGKPLSL
SRSYIMSCEEERKRIKQHKAIITEDGKVNGVTESTRILGYTFLHPSVVPRPHVQSVLLTP
QDEFFILGSKGLWDSLSIDEAVEAVRNVPDALAAAKKLCTLAQSYGCHDSISAVVVQLSV
TEDSFCCCELSAGGSMPPPSPGIFPPSVNMVIKDRPSDGLGVPSSSSGMASEISSELSTS
EMSSEVGSTASDEPPSGVLNESSPAYPNEQRCMLHPVCLSNSFQRQLSSATFSSAFSDNG
LDSDDEEPIEGVFSNGSRVEVEVDIHCSRAKEKERQQHLLQVPAEASDEGIVISANEDES
GLSKKADFSAVGTIGRRRANGSVAPQERSHNVIEVAADAPLRKPGGYFAAPAQPDPDDQF
IIPPELEEEVKEIMKHHQEQQQQQQQQQLPPPPQPPQPQPQPQPQPQPQPQRHFQMDHLP
DCYDTPL
NT seq 5064 nt   +upstreamnt  +downstreamnt
atggagcccgccgctgcagccccggcacagcgactcgcggaccccacgggtgaggaccaa
gccctggcggcggcggcggccgagggcggccggtgtccggatcccgcgctgagcgcggcg
gccccgagcggcgggaacggcggcgcggcgcgagaggaggccccctgcgaggcgccgccg
gggccgctgcccggccgcgccggaggcaccgggcgcaggcggcggcggggagctccccag
cccgcggccggtggggccgctccggtgcccgcggccggcggcggcgccaactcgctgctg
ctgaagagagggcggctgaagaggaatctgtcggccgccgccgccgcctcgtcgtcctcg
tcgccgtcctcggcgtcttcggccgctggcggcctcccggcgtcctgctcggcctcggcg
tcgctgtgcacccggagcctggacaggaagacgctgctcctgaagcaccggcagctgctt
cagctgcagccgtcggacagggactgggtgaggcaccagctccagcggggctgtgtgcac
gtctttgaccgccacatggcctcgtcctacctgcgcccagtgctctgcacgctggacacc
acggccgccgaggtggcggcccggcttctgcagctgggccacaaaggcggcggggtggtg
aaggtgctgggctacgggccgcctcccgccgccgcccctgccgccagcgatcagaccctg
gacggagagcacggaagggacgtggagccaccgccctcgagcggcactgttggtgctgtc
cggggccctgcgcgcgcgcctcccgccgatctgccgctgcccgggggcgcctggacgcgc
tgtgcaccccgcatcagccccgcgccttcggactccagccccggagagctgttcgcgggc
ggccccgggtcccctccccgcgccccgcgcccggcctctgacaccgagagcttcagcctg
agccccagcgccgagagcgtgtcagaccggctggacccctacagcagcggcggcggcggc
tcctcgtcgtcgtcggaggagttagaggctgatccggccatgccccaccgccccggccgc
cccgcgcagcctcggccgccttccccgaagacctcggctttactgcagccgaaagccccg
acgggcgtagacagcactggcgtgatagcgggcgagggtcccggagacgataaggcgatg
gcagccgcagctccggacgttcctctgtcgacttcggggaggatacgggagaccgtgcaa
aagacatctccgccctccctgtatgtacagctccatggagagactacccggcgcctggag
gcggacgagaagccattgcagatccaaaatgactacctcttccaactgggatttggggag
ctgtggagggtgcaggaggaaggcatggactcagagattggctgtctcattcgattctat
gcaggaaagcctcatagcactgggagctctgagcggattcagctctccggaatgtacaat
gtccgaaaaggcaaaatgcagttgccagtgaaccgatggacaagacgacaggtcattctg
tgcgggacgtgcttgatagtgtcgtccgtgaaagacagcgtgagtgggaagatgcatgtc
ctgcccctcattggtggaaaagtggaggaagtgaaaaagcaccagcactgtttagcgttc
agctcttcggggcctcaaagccagacttactacatctgctttgatactttcacggagtac
ttacggtggctgcggcaagtctccaaggttgcatcacagcgtataagctcagtagacctc
tcctgttgtagccttgaacatctgcctgccaacctcttttacagccaagaccttactcat
ctcaacttaaaacagaacttcctaaggcaaacccccaccctcccagctgccagaggactt
ggtgaactgcaaaggttcaccaaattgaagagccttaacctttccaataaccacctagga
gcctttccgtcagcagtctgcagcattccaaccctagcagagctgaatgtatcttgcaat
gccctgcgagaagtcccagcagctgttggagatatgcagaacttgcagacgtttctgctg
gatggaaattttctccagtcccttcctgctgaactggagagcatgcaccagctcagctat
ctgggtctttcctttaatgaattcactgacattccagaggtattggagaagctgactgct
gtggataagctgtgtatggctgggaactgtgtggagaccctcagactacaggccttaaga
agaatgcctcatattaaacatgtggacctaagactgaacatactcagaaagcttatggca
gatgaggtggactttgtgcaacatgtcactcagcttgacctgcgagacaataagcttggt
gatctagatgctatgatcttcaacaacatagaagttctgcactgtgagaggaatcagctg
gtgacattgaacgtttgtggctatttcctaaaggcactctatgcttcttctaatgaactt
gctcaacttgatgtctacccagttccgaattatctctcttacatggatgtctcaagaaac
tgcctagaaagtgtgcctgagtgggtatgtgaaagccggaaattagaagttttggatatt
ggccataatcaaatatgtgaacttcctgcccgcctgttttgtaatagtagtctccggaaa
ttgctagcaggacacaaccggttggcaaggcttcctgaaaggctggagagaacttctgtg
gaggtcttggatgtccagcacaaccagatcactgagctcccaccaaacctcctcatgaag
gctgacagcctgagattcctgaatgcatctgcaaacaaactggaaaccctgcctccagcc
acactttctgaggagacgagcagtatattacaggagttgtacctgacaaacaactgcctc
acggataagtgtgtgcccttgttaacagggcacccccgtctgaagatcctacacatggcc
tataaccggcttcagagcttcccggcaagtaaaatggcaaaactggaggaacttgaagaa
attgatatcagtgggaataagctgaaagccatccccacaacaatcatgaactgcagacgc
atgcacaccgtgattgctcactccaattgtatcgaagtctttcctgaagttatgcagctc
ccagaagtcaagtgtgtagatctgagctgtaatgagctgagtgaaatcacgttaccagaa
aacctgccacctaagctgcaggagctagacctgactggaaatccacgccttgccctggac
cacaaaagcctggagctgctcaataacattcgctgcttcaagattgaccagccgtcagca
ggagatgcatcaggagccccagcagtatggagtcatggttacactgaagcatcgggagta
aaaaacaagctgtgtgtcgcagccctgtctgtaaataacttccgtgacaaccgagaggcc
ctctatggtgtgtttgatggagaccggaatgtggaggtgccctaccttctccagtgcacc
atgagtgacattttggctgaagagcttcagaaaacgaaaaatgaagaagaatacatggtc
aatacattcatagtcatgcaaaggaaactgggaactgctgggcagaaacttggtggtgct
gctgtcctctgccacatcaagcctgaccctgtggacctgggaggatcctttaccctgacc
tctgctaatgttggcaagtgccaaacggttctctgtcgaaatgggaagccactgtctctg
tccaggtcatacatcatgagctgtgaagaagagcggaagaggattaagcagcacaaagcc
atcatcactgaggatggcaaggtcaatggagtgacagagtccacgcgcatcctgggctac
accttcctccatcccagtgtggtgcctcgcccccatgtgcagtcggtgcttctgactcca
caggatgagtttttcatcctgggcagcaaagggctgtgggacagcctatccattgacgag
gctgtggaagctgtacgcaatgtgccagatgctctggctgctgctaagaagctctgcacc
ctggctcagagctatggctgccatgacagcatcagtgctgtggtggtacagctaagtgtc
accgaagacagcttctgctgctgtgagctcagtgctggagggagcatgccaccacccagc
cccggaatcttcccaccatccgtcaacatggtcatcaaggaccgaccctcagatgggctg
ggtgtgccatcctccagcagtggcatggcatctgagatcagcagtgaactgtctacctcc
gagatgagtagtgaggtgggctccacagcctctgatgagcccccgtctggagtcctgaat
gagagcagccctgcctaccccaacgagcagcgctgcatgctccaccctgtctgcctgtct
aactccttccaacgtcagctgtccagcgctactttctccagcgcgttctctgacaacggc
cttgacagtgacgatgaagaacccattgagggggtgttcagcaacggcagccgggttgag
gtggaagtagacatccactgcagcagggccaaggaaaaggagagacagcagcacctactt
caggtgccagctgaggccagtgatgagggcattgtcatcagtgccaatgaggatgagtca
ggtctgtccaagaaggcagacttttctgctgtgggaaccattggacgacgcagggctaat
ggctctgtagctccccaggaaaggagccataatgtgatagaggttgctgcagatgcgcct
ctccggaagccaggaggctattttgcagcccctgctcagccagatccagatgatcagttt
atcatccccccagagctggaagaggaagtcaaagaaatcatgaaacatcaccaggagcag
cagcagcagcagcagcagcagcagctgccaccaccaccccagccgccacagccacagcca
cagccacagccacagccacagccacagccacagcggcacttccaaatggatcacctgcca
gactgttacgatacaccgctatga

DBGET integrated database retrieval system