KEGG   Mus musculus (mouse): 244653
Entry
244653            CDS       T01002                                 

Symbol
Hydin, 1700034M11Rik, 4930545D19Rik, 4932703P14, 672398, A830061H17, AC069308.21gm4, Gm9558, hy-3, hy3, hyr, hyrh
Name
(RefSeq) HYDIN, axonemal central pair apparatus protein
  KO
K17570  hydrocephalus-inducing protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    244653 (Hydin)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     244653 (Hydin)
SSDB
Motif
Pfam: Hydin_ADK ASH PapD-like Motile_Sperm DUF1573
Other DBs
NCBI-GeneID: 244653
NCBI-ProteinID: NP_766504
MGI: 2389007
Ensembl: ENSMUSG00000059854
Vega: OTTMUSG00000061892
UniProt: Q80W93
Position
8 D3- E1; 8 57.5 cM
AA seq 5154 aa
MTLKIKCVANYIKEKIPNVLFLCDPEARLQQLTASVPLCEQRKYFKQTNKRLEESMGAMH
RKMAKVISGLQSKVLPPMSPKVVTEEEVNRMLTPSEFLKEMSLTTEQKLASTRIICRPQI
TELLDMGETTHQKFSRVDLDQALFQPFPSEIIFQNYSPCEVYEVPLVLRNNDKIPRMVKV
VEESSPYFKIISPKDIGHKVAPGVPSVFRILFTPEENKDYAHMLTCITEREKFIVPVKAR
GARAILDFPDELNFSTCPVKYNTQKVLLVRNIGNKDSMFHLKTRSPYSVEPTGGILNVGE
SMQLEVDFEPQTVGSHDGKLIVTYDTGEMVFVCLYGVAIDVNIRLDKNSLIMEKTYISLA
NQRSITIHNRTNIIAHFQWKVFATEEEEDKEKYKICDGLNKEEKQETSMILEDSVLDPSL
RERLSIISRTFENQRKLVQGDSMLFLDHVFTIEPPEGDVWPNSSAEITVYFNPLEAKLYQ
QTVYCDISGREIRLPLRIRGEGMGPKLHFNFELLDIGKVFIGSAHCYEAILSNKGSIDAL
FNVIPPTSALGACFVFNPKEGIIEPSGVQAVQISFSSTILGYFEEEFLIDVNGSPEPVKM
TIRGCVIGPTFHFNVPALNFGNVSYGFPHTLMCSLNNTSLVPMTFKLRVRGDGEGMSSIP
SYSQESDSKQWSGINTEMPTTKPKEFTISPNSGTIRAQGFTAIKVTLCSNTVQKYELALV
VDVEGIGEEVLALLITARCVVPKLQLVTTEVDFGRCFLKYPYEKTIQLVNHDDLPGCYKV
LPQLYENSPPVLLSSPSPCGVISPHSTVSIPLALETQVIGAHRSIVYISVFGSQEAPLAC
NIQSIGEGPVIFIHPTQIDFGNIYVLKDTSRILQLSNQSFIPAVFRVRMANKKSLWTVKP
SEGAVPAEDDIPLTLTANLDDIVTFKDTVILEIKHSNTYRIPIQATGIGSTIVSDKPFAP
ELNLGAHFSLDTHYYRFKLTNKGRRVQQLFWMNDDFRPKEKQSKKEPGKKGSTSSSRRQS
KASQEPTDNGNPVFQLYPVRMELYPGQTIDVILEGYSATPKKVKEKLVCQAIVGTQKGKS
LLMSVNIICEFIAPIIQLSAKQLLYRLEKKPNSNLESDYQSLVIKNITTLPVNMLLSTTR
PFFICETDKSLLPATPKPIKLEVDEEKHLLIKFDPSYRNDLNNWVAEEVLSIKYLEHPQV
DNLGLRAEVHYPNLSFEVMDIDFGCILNDTEVIRYIMITNCSPLVVKFRWFFLVDEEENQ
IRFAPCMKPYSAFLSQMESIAATSVTASSLAAPHTVEYTEMDFSDSIKTILMDDEAGPEE
IKKPATSTMVSEAIKYSSAGTERSQSQPDYPECMWIYEQDEMLSIGIEEVFDILPLYGVL
RPYSSHQISFTFYGHCDIIARAKALCEVEGGPTYEVLLKGEASLVNYSFDTKDINYGLQL
FDHVTEREITLKNTGKVGFEFNVLSNYRSSQRNLLPGVPLILPLSGFIQSNKEQVLKVYY
LPGIPEVFQRNFQIQIAHLVPENITLYGEGIFPRISLDLHRNLQGNEKYEHFLEQAKKNV
EKEYTKYEAVDQYEVMAEELPEEETAEISAHVQMEVERLIVQDYALEHQRSISNNTEDIY
FSQRSCRKLTKVQLPEYILDFGYIVLGDVRTHIVKITNTSHFPVSFHAEKQVLHETGFST
ELDRVKNLPYYETETFEVRCDPQGANLPVGNKEVILPIKVYGGPTIHLCLQATVIIPSMT
LSCNKIEFATIQCGQCMVETIQLSNHLQVPCEWFVHTPKSTNKLDKHMPKYLRRKLQAEM
IPKSRIFEIQPTSGILDPGERANVQVKFMPKEEKLYSQSLLFQIGQSSQKLTLLAQGQGL
EPRLEFSPSVLELGPLLPFASGDEAEVIVRNPCNFPIEFYSLEFDQQYLLEEKMLRQLKG
YDSYNTLLLPPRNPGEKLPPEVYDYFKEMKKSKEEHMKAKYMENLENEEEEMNTSDQGTT
STKRTSISRGISVTSNLEERHLTIEAKNYLDEDDYEESLEKLTFQTDKMQSTDSHSVEEV
GEVESNPVSKAIARHLGIDISAEGRLAKNRKGIAIIVHGTPLSGKTANAISMAKFYNAAC
LNIDSIVLEALSDTNNILGIRARELCIRAAIEQSMREAEESAHESSMTQNTVVPARLSTE
NLGRFTSELTLITQEYKVPKTVRGSVMLPKGKADSHFTGSQKQHHQHQSETPQVQISSSP
LLPGPTHRRLSVSASIGGETGLMSCVLPDDLLIQILAERIQLSNCFRGVVFDGLDTLFAR
NAPSALHCLLKAIGSREHIYVINMSQDYVVMKAQEKAKKEQEENKRKEALAKEKERLQTL
DEDEYDALTAEEKVAFDRDVRQALRERKKRELERLAKEMQEKKLQQELERQKEEDELKRK
VKRPKAGPAAKEEPPLKKAQGATNKQLAAVAKIELKMESIERKVSVREHATLEETTRKKK
AMTEYPLLIPISQEQEDSEGDFLKDSDKNLAQKFKIYDMCLKDVQNILMYWDRKQGMMVP
HTGTDEMSHEADDQRQAPSGGGGRKGRKDRERERLEKERAEKERLEREKAERERLEKLKA
LEERSDVEGEGEEEHEGKKDLGVPFINIQSPDFEGVSWKQALESDKLPKGDQILDILGLG
SSGPPIPPPVLFSIISYPAKRQSLVATEILKHFVFVIPPNDDIPLMDEKKDPEGDSDIFL
NTIITKAQEEQPSPPKGSKQKLKDKPEQVRETQKEKRRTYSSRKGLPGGTSGSIVPMSDI
DQNSFDGEHSQEKFIRLNHFRWIVPPNGEVTLRVHFSSLDVGNYDQTFNFELLGTRRQYQ
LYCRGVCTYPYICRDPKVVFSQRKKDMKLKEVVVKKYVVSMEKFYFGPLLCGKSRDKYKS
SLFPGNMETLTILNDSPMVVEAYFCFQHDIKASTYFLEPVNMTLKPNEKQALNVWAYPTA
VGIFEDSIVCCIKENPEPAIFKLSCQGIRPEIEVEPRQLHFDRLLLHRKETKIVILRNVT
PLPVAWRISNLEHLGEDFTVSMMQGTMLPKGEYGLQVHFQPSKPVNIKKAIRIEVLDAEN
LVGVVQIENILIFAESYDIALDITFPKGAEGGLDFGTLRVMEEVKQTLQLKNRGKYEIIF
SFTVDTLGVLPTNLSSMISVQPKRGTLASIDKPTTVQVFFRARKEVKIDCQPILRCQIIE
PTLPEGEIIASIPIKFSVNAVYSKFTISPSSIINFGALICGTRKSITFTIENQGIIDFKY
ALYRLTGESPILQKKITSHMRHGRTRESESFYKPGATKMAKFSDTVQKDTNIANQARFTH
GMFTVYPGFGSIPSGGQQVITIECFADPVGRCEEFLAIDISDRDPRENPAGIPYTLLAEA
CLPAFVTDNNILIFEEHQICTSPNLYHILQTIQSGGLFVEDENKFIFCNVLVGHQAKARF
KISNVGKISCDINIVIKPISNKPANRITDTFDVEPSKMCIGSRSHAFVTVLFTPQTMQTY
QCIFEATLDGLPSNIARSRGLVFDIVGEGTLPRVTVIRPTLYNQHGNPLLLFKRLLLGHS
EKLPLILKNNGTIPAQLHVDLRDQLGVFSLKGRPTTSYIYIMEENKPNEKVKKAHTASLV
VSPGDTAEFDVFFHSNKIGRMTGTIHLSVINNQYEETMIHLVGESYEDDITLDNIHGLIS
STSQESSDKSEVIEIAEESTMEDLVTAALMEHIQFGYCHIGISYNVSFTITNHSQVNVIR
FEWPLLATLSFSPQIGHLHPGCSKDVVVTLKSESPITLKKMCVKCKLSKIMFQLPVDQVP
DWDDRMRTVKWVDAPRNTPLTLNTKRKVIEMDPEPAHSVVEENYRELRIQFSANVDFASY
QCETTEVFFKETLVYQTRVFEFDLVNTGQVLLEFCWISEEASKAVSFAMPERQGSSQKEL
SQGSGSSLDSALDRWTEASPSPFSVEPPSGVVPVGKTQKLKVKFSPMDIGEFESSLYCQI
PNLPLGEQGPILITKGRSVLPFCHFDLKESDYISGHRRNPELRGPGAGPLEPNTRVIEFT
SVGIGGKNVQTFTILNPTNSTYSFCWTSEETESLQHPPAFVCLTEKGIIHPEKKAEIIFQ
FLPAHLDITEEFWTFSIPEHNISVPFLLVGKTTDPLISLDKSHLNFSSLLIGREARETVK
IINKEEQGFNFAFQDNSRYSEGFNNSLIVCPMEGWIPPLSRFPVDIFFTPKQEGDVNFNL
ICNIKKKAHPLTLNVKAEGYTMNAEVKCRDRMGTTILLTSTQVNTINFYEVELNECVQCE
FSFINTGKFNFSYQAELSGPKLLLQYLDFTPTDSSVDVGQSEPANLSFQPYQKCVLKGLE
LKIKISHGPTFVCNILGCAVSPAVHFSFTSHNFGTCFIYQAGMPPYKQILVVTNKEETSM
SLDCLYTNTPHIEVNFNVDVIKPGKTLEIPITFYPREAISYRELIPFEINGLSQQTVEIK
GKGTEMKLLVLDPANRIVKLGAVLPGQVVRKTVSLVNNSLAQLTFNHSVLFSIPELQEAK
VITLEPFHTITMKPKEVCKLEITFAPKKRVPPFSEEVFMEWMGLLRPLFLLSGCCQALEI
SLDQEHLPFGPVVYQTQATRRILIMNTGDVGARFKWDVKKLKPHFSISPEEGYIISGTEV
ALEVTYHPTEIGKESLYKNILCFIQGGNPLCLTLSGTCVGPPVVKEVVNFNCQVRSRHTQ
TILLSNRSNQTWNLHPIFEGEHWEGPEFITLEAHQQNKPYEITYKPRTMNLENRKHQGTL
FFPLPDGTGWLYALHGTAELPKAVANIYREVPCKTPYTELLPISNWLNKPQRFRVIVEIL
KPEKTDLSVTLKGLDYIDVLSGSKKDYKLNFFSYKEGLYTAKVIFRNEVTNEFLYYTVSF
RVTPSGIIKTIQMTSPVRQSVSASIKLENPLPYSVTFSTECKLSDISLPSQFAVPPNSEG
TFSFEFQPLKAGELCGRLTLHNSDLGYYQYELALKALPAPPEKPVHFQTVLGSSQSILAK
FTNYTRLKTEYYCKTDCSDFHTEKVINAAPGAQGGTEVSVEVFFEPSHLGETKGILCLSS
LIGGEYIIPLFGIALPPKPQGPFLIRAGYNIIIPFKNVFLHATSFSFIVENPAFSIRAAE
TVRPKKINNITVYFEGNPSGSKTPITSKLIVTCPQCEGTESGIKWVYYLKGITP
NT seq 15465 nt   +upstreamnt  +downstreamnt
atgaccctgaagatcaaatgtgtggctaattatataaaggaaaaaatcccaaacgtgctc
ttcttatgcgaccctgaagcaagactgcaacagttaaccgcctctgtgcctctctgtgag
caaagaaaatatttcaaacagacaaataaaaggctagaggagtccatgggggccatgcat
cggaagatggccaaagtgatctcaggactgcagagcaaagtcttaccacccatgagcccg
aaggtggtcacagaggaggaagtgaaccggatgctgacaccctcagagttcctgaaagag
atgtccctcaccacggagcagaaattggcaagtacaagaattatatgtcgaccgcagatc
accgaactcttagatatgggagaaacaacacatcaaaagttttccagagttgacttggat
caggccttgttccagccctttccgtctgaaatcatattccagaactattctccctgtgaa
gtctatgaggtgccattggttttaaggaacaacgacaaaatcccacggatggtaaaagtt
gttgaagaaagctcaccttactttaaaatcatcagccccaaagacatcggccacaaggta
gcccctggtgtgccatctgtattccgaatcctcttcactccagaggagaacaaggattac
gcccacatgttgacctgcatcaccgaaagagaaaagttcattgtgccggtaaaagccaga
ggggctcgagccatcctggactttcccgacgagctgaatttctccacttgccctgtgaag
tacaacacccagaaggttctgctggtccgaaacattggcaacaaagactccatgttccac
ctcaaaactcgcagtccatactcagtagagccaacgggcgggattctcaacgtgggcgaa
tccatgcaactggaagtggattttgagccacagactgtgggcagtcacgatggaaaactc
attgtgacttatgacacaggtgaaatggtatttgtatgtctctatggagttgccatagat
gtgaatataagactggacaagaattcgttgatcatggagaaaacctacatatctctggcc
aaccagcggtctataaccattcacaatcgcactaatataattgcccacttccagtggaag
gtgtttgccaccgaagaagaggaagacaaagaaaaatacaagatctgtgatggcctgaac
aaggaggaaaagcaggaaaccagcatgatccttgaagacagcgtcttggatccctcgctc
cgagagcgcctctccatcatctcccggaccttcgagaaccagaggaaactggtccaagga
gacagcatgctctttctggaccacgttttcacgatcgagcccccggaaggtgatgtctgg
cccaactcatccgctgaaatcactgtgtactttaacccgctagaggccaagctctaccag
cagacagtttactgtgacatttcaggccgagagatccgcttgcccctccgaatcagagga
gaaggaatggggcccaagcttcacttcaacttcgaattactggacattggcaaagttttc
attggatctgctcactgttacgaggcaatcctgtccaacaagggcagcatcgatgccctc
tttaacgtcatccccccaacttcagccttgggggcctgctttgtcttcaatcctaaagaa
ggcatcattgaaccgagtggggtccaagctgtccagatctccttcagttctaccatcctg
gggtacttcgaagaagagttcctgattgatgtcaacgggtcccctgagcccgtgaaaatg
accattagaggctgtgtaattggacctacattccattttaatgtccctgcactgaacttt
gggaatgtttcctatggatttccccataccttgatgtgttccctcaataatacatctttg
gtccccatgaccttcaaactgcgtgtccgcggcgatggcgaaggcatgagtagcatccca
agttactctcaggagtcagacagcaagcaatggtccgggattaatacagaaatgcctacc
acaaaacccaaagaattcaccatctctcccaacagtggcaccatccgtgcccagggcttt
actgccatcaaggtgaccttgtgttccaacaccgtgcagaaatacgagctggcgctggtg
gtagacgtggagggtatcggagaagaagtgctggcactcttaattacagccaggtgtgtg
gtccccaagctccagttggtgactacagaggtggactttgggcgctgcttcctgaagtac
ccatatgagaagaccatccagcttgtcaatcatgatgaccttcctggatgctataaggtc
ctgcctcagctgtatgagaattcaccccctgtgctgctctccagcccctccccctgtggg
gtcatctccccccacagcactgtgagcataccactagccttggagacacaggtcattggc
gcacatcgatccatagtttacatctccgtctttgggagccaggaagcccctctggcatgt
aacatacagagtattggagaaggccccgtgatcttcatacatcccactcaaatcgacttt
ggcaatatctacgtcctgaaggacacctccagaattctccagctctctaaccagtccttc
atccctgcagtatttcgggttcgcatggcaaacaagaaatccctttggacggttaaaccc
agtgagggtgcagttcctgcagaagatgacatcccactgacactgactgccaacctggac
gacatagtgacgttcaaagacacggtcatcctggagattaagcatagtaacacctatcgg
atccccatccaggccaccgggattggttctaccattgtttccgacaaaccatttgctcca
gaactcaacttgggagcgcattttagcctggatacccactattaccgcttcaagctgacc
aacaaaggacgccgagtccagcaactgttctggatgaatgatgacttccgccccaaggaa
aagcagagcaagaaggaaccggggaaaaagggctctacttccagtagccgtcgccagtcc
aaggcctcccaggaacccacagataacgggaaccccgtgttccaactttaccccgtcagg
atggagttgtacccgggacagacgattgacgtgatccttgaaggctattccgccacgccc
aagaaagtcaaagagaagctggtgtgccaggccatcgtcggaacccagaagggcaaaagc
ttgctgatgtccgtgaacatcatctgcgagtttatagctccaatcatccagctctccgcc
aagcagctactatatcgactggaaaagaagccgaactctaacctggagtctgattaccag
tccttggtgataaagaacatcaccaccctgcctgtgaacatgctgctctctacaaccaga
cccttcttcatatgtgagactgataagtccctactgcctgcaacccctaagcctataaaa
ctggaggttgatgaggagaaacacctcctgatcaagtttgatccctcctacagaaacgac
ctgaacaactgggtggcagaagaggttctgtcaattaagtatctagaacaccctcaggtg
gacaacctgggcttgcgtgctgaagtgcattaccccaacctcagctttgaggtgatggac
atagatttcggctgcatcctgaacgatactgaggtcattcgctacatcatgatcaccaac
tgcagccccttggttgtgaaattccgctggttcttcttggtggatgaggaggaaaatcag
atcaggtttgcaccatgtatgaagccctacagcgccttcttgtcccagatggagtccatc
gcggccacctcggtcaccgccagctctctggcagccccacacactgtagagtatacggag
atggacttcagtgattccatcaagacgatccttatggatgacgaagctggacccgaagaa
atcaaaaagcccgcgacatccaccatggtctcagaagcgataaaatacagctccgcggga
acggaaagaagccagagccagccggactacccagaatgcatgtggatctatgaacaggat
gagatgctgtctattggaatagaagaagtgtttgacattctgcctctctacggagttctg
cggccctacagcagccatcagatatcgtttaccttctatggacactgtgacatcatcgcc
cgggccaaagctctgtgtgaggtggaaggagggcccacctatgaagtactactgaagggg
gaggcgtccctggtcaactactcctttgacacgaaggacattaactatggattgcagctg
tttgaccatgtcacagaacgtgaaatcacactgaaaaacactgggaaagttggctttgag
ttcaatgtactgtctaactaccggtcttcacaaaggaaccttctccctggagtaccactt
atcctgcctctgtcgggttttatccagtcgaataaggagcaggtattgaaagtttactac
ttgcctggaatacctgaggtctttcaaagaaacttccagatacagatcgcccacctggtc
ccagaaaacatcaccctgtacggagagggcatctttccacgaatcagccttgacctacac
aggaacctccaaggcaatgaaaagtatgaacacttcttggaacaagcaaagaaaaacgta
gaaaaagagtacactaaatatgaggctgtcgatcaatatgaggtgatggctgaggaactc
ccagaggaggagaccgctgaaataagtgctcatgtccagatggaagtagagcgactcata
gtccaagactatgccctggaacaccagagaagcatctccaataacaccgaggacatctac
ttcagtcagcggagttgccgaaaactcaccaaagtccagctgccagagtacatcctggac
ttcggctacattgtacttggtgacgtcagaacccacatcgtcaagatcaccaacaccagc
cacttccctgtgtccttccacgcagagaaacaggtccttcacgaaacaggcttcagcact
gagctagaccgtgtaaagaacctgccttactatgagacagaaacatttgaagtgaggtgt
gacccacaaggggctaatctccctgtggggaacaaagaagtcattctccccatcaaggtg
tacggagggccaaccattcacctctgcctccaggccacggtgatcatcccaagtatgacc
ctgtcgtgcaacaaaatagagtttgccacgattcagtgtgggcagtgcatggtggaaacg
atccagctttccaaccatctccaagtcccttgtgaatggttcgtccacaccccaaagtct
actaacaagctggacaaacacatgccaaagtatttacggcggaagctgcaagccgagatg
attcccaagtctcggatctttgagatccaacccacttctggcatcttggatcccggcgag
agggctaatgtgcaagtgaaattcatgcccaaggaagagaaactttacagccagtctctg
ttgttccaaattggccagagctctcagaagctgacacttctggcccagggtcaaggcctg
gagccacgcctggagttcagcccttccgttctggaactggggcccctcctgccttttgca
tcaggagatgaggccgaggtgattgtgaggaacccctgcaacttccccattgagttttac
tccctagaatttgaccagcagtatctcttagaagagaagatgttgcgacagctgaagggc
tacgactcctacaacaccctgctgctgcctccccggaacccaggggagaagctgccacca
gaagtctatgattactttaaggagatgaagaaatcgaaagaggagcacatgaaggccaag
tacatggagaacctggagaacgaagaggaagaaatgaatacgtctgaccaaggaaccacc
agcacaaagaggacatcaattagccgagggatctcagtcacatccaacctggaagagcgg
catctcacaattgaagccaaaaactacctagatgaggatgactatgaagaaagcctggaa
aaactaacatttcaaaccgacaagatgcagagcacagacagccactccgtagaggaggtt
ggagaggtggagagcaatccagtgagcaaggcaatcgcacgccacctgggcatcgacatt
tctgcagaaggccgcctggccaagaaccggaagggcatcgccattatcgtccacgggacg
cccttgtcaggaaagacagccaatgccatcagcatggccaagttctacaacgcagcctgc
ctgaacattgactccatcgtcttagaagccctatcagacaccaacaacatcctagggatt
cgggcccgggagctgtgcatcagagctgccatagagcagtccatgagggaagcagaggag
tcagctcatgagtcttcaatgacccaaaatactgtggtaccagcacgactaagcactgag
aacttgggcaggtttacctcagagctcactctaataacccaggaatacaaagttccgaag
accgtgcgcgggagtgtgatgctccccaaaggcaaggcggacagccactttactgggtct
cagaagcagcatcaccagcaccaatccgaaacaccgcaggtacagatctcctctagccct
ctcctccccggccccacccatcggcggctcagcgtcagcgccagtattggcggggagacc
gggctgatgagctgcgtgctcccagatgacctcctcattcagatcctggctgagcggata
cagctgagcaactgtttcagaggcgtggtgttcgacggcctggacacgctctttgcacgg
aatgcgccctctgccctccactgcctgctaaaggccatcggcagccgggagcacatctat
gtcatcaacatgtctcaggattatgtcgtcatgaaagcccaggagaaggctaaaaaggag
caagaagagaacaaacgcaaggaagccctggcaaaggagaaggagcgtctccagacactg
gacgaggacgagtatgacgccctaacagcagaagagaaagttgcatttgaccgtgatgtt
cggcaggcactccgggagagaaagaagagggagctggaaagacttgccaaggagatgcag
gagaagaagctgcagcaggagctggagaggcagaaggaagaggatgagctaaaacggaag
gtcaaaaggcccaaagcaggccctgcggcaaaggaggagccacccctaaagaaagcacaa
ggcgccacaaacaagcagcttgctgcagttgccaagatagaattaaagatggaatcaata
gaaaggaaagtttctgtcagagagcacgcaacacttgaagaaaccaccaggaagaagaaa
gccatgaccgaatacccactcttaattccaatttcccaagaacaagaggacagcgaagga
gacttcctgaaggactctgacaagaacctggcacaaaagtttaaaatctacgacatgtgt
ctgaaggatgttcaaaacatcctcatgtattgggaccgcaagcaagggatgatggtacct
catacaggcacggacgagatgtcacatgaggctgacgaccagcgccaggcgccttcaggg
ggcgggggtcgcaagggccgcaaggaccgggagagggagcgcttggagaaagagagggct
gagaaggagcggctggaaagggagaaggctgagagggagcggctggagaagctgaaggcc
ctggaggagcggagcgacgtggaaggggaaggggaagaggagcatgaaggaaagaaggat
ctcggggtgccctttatcaacatccagtctccagacttcgaaggtgtaagctggaagcaa
gctctggagagtgacaagcttcccaaaggagaccagatcctggacatcctaggcctgggg
tcctcaggaccacccatccctcctcccgtcttgttctccatcatctcttacccagcaaag
cggcagtctttggtcgccacggagatcctaaagcactttgtgtttgtgattccaccaaac
gatgacatccccctgatggacgagaaaaaagacccggaaggagattcagacatcttcctc
aacaccatcataaccaaggctcaagaggaacaaccctctccacctaagggaagcaaacag
aaattgaaagacaaaccagagcaagtgcgggaaactcagaaggaaaaacgacgcacttac
tccagcaggaaaggcctccctgggggaacatcggggagcattgttccgatgtctgacata
gaccagaacagctttgatggagaacactcccaggagaagttcatcaggctgaatcacttc
cggtggattgtgcctccaaacggagaggtaaccttgagagtgcacttctcctctctagat
gttggcaactatgaccagacgtttaatttcgagctccttgggacccgccgccaataccag
ctctactgccgcggagtctgcacctacccatacatctgcagagaccccaaagttgtgttt
tctcagaggaagaaagacatgaagttaaaagaagttgttgttaagaagtatgttgtgagc
atggagaagttttactttgggccactgctttgtggaaagtcaagagacaagtataagtca
tccttgttccctggcaacatggagacactgacgatcctgaatgattctccaatggtggta
gaggcatacttctgtttccagcatgacataaaagcaagcacctactttctagagccggtc
aacatgactctgaaacccaatgaaaagcaggcactaaacgtatgggcctaccctactgca
gttggtatctttgaagacagcattgtctgctgcatcaaagagaacccagagccagccatc
tttaagttaagctgccaaggaattcgcccagaaattgaggtggagcccaggcagttacat
tttgaccgactcttgcttcataggaaagaaaccaagatagtaattctccgcaatgtcacg
cctcttcctgtggcctggcggatctccaacctggaacacctaggggaggactttactgtg
tccatgatgcagggcaccatgctacccaagggagagtatgggctgcaagtgcacttccag
ccctccaaacctgtcaacatcaagaaggccattcggattgaggttttggacgcagaaaat
cttgttggtgtcgttcagatcgaaaacatcttgatctttgcagaatcgtatgatatcgct
ctggacatcaccttccctaaaggagctgaaggaggtctggattttgggactttgagggtc
atggaggaggtaaagcagacccttcaactgaaaaaccgtggaaaatatgagatcatattc
agcttcactgtggacaccttaggggttttgccaacaaacttaagttccatgatctcagtc
caacccaagagggggacactggcctcaatagataagcccacaactgtccaggtgttcttc
cgagcaagaaaggaggtgaagatcgattgccagcccatcctgcgctgccagattattgag
ccaactctcccagaaggtgagatcattgccagcatccctattaagttttcggtgaatgca
gtatactccaaattcaccatcagcccctcctccatcatcaattttggggctttgatctgc
ggtaccaggaaaagcatcaccttcaccatagaaaaccaaggcataatcgacttcaaatat
gccctctacaggctgacaggggagagtccaattcttcaaaagaagataaccagccacatg
aggcatggaagaacccgagagagtgaaagcttctacaagcctggagcaactaaaatggcc
aagttctcagacacagtccagaaagacacgaacatagcaaaccaggcccgcttcacccat
ggcatgttcactgtatacccaggattcggctccatcccttctggaggacagcaggtgatc
accattgagtgttttgcagaccctgtggggaggtgtgaagagtttctggccatcgatatc
tctgaccgagaccctagagaaaatcctgccggcatcccttacactctgcttgctgaagca
tgtctgccagcctttgtgaccgacaacaacatcttgatatttgaggagcatcagatctgc
accagccccaacctgtaccacatcctacagaccatacagagtggggggctgttcgtggag
gatgagaacaagttcatcttctgcaatgtcctggtgggtcatcaggccaaggctcggttc
aagatcagcaacgtgggcaagatctcctgtgacatcaacattgtcatcaagcccatctcc
aacaagccggccaaccgcatcactgacacctttgacgtggaacccagcaagatgtgcatc
gggagccgctcacatgccttcgtcacagtgctgttcacaccacagaccatgcagacctac
cagtgcatcttcgaggccactttggatggcctgcccagcaacattgccaggagccgaggt
cttgtgtttgatattgttggtgaggggactctccctcgagtgactgtcatccggccaact
ctatataaccaacacggaaaccccttgctcctgtttaagaggcttctgcttggtcattcg
gagaaactgcctctcatccttaagaataacggcaccatccccgcccagctgcatgtggac
ctgcgggaccaactaggagtcttctctctgaaagggagacccaccacctcctacatctac
atcatggaggaaaataaaccgaatgaaaaagtcaagaaagcccacacggcctccctggtt
gtttctcctggagacacggctgaatttgatgtctttttccactccaataagattgggaga
atgacaggcaccatccacttatcagtgatcaacaaccagtatgaggagaccatgatccac
ctggttggagaaagctacgaggatgacatcaccttggacaacatccatggactgatcagt
tccaccagccaggagagctcggataagtctgaagtcatagagatcgccgaggagagcacc
atggaggacttggtgacagctgccctgatggaacacatccaatttgggtactgtcatatt
ggaatcagctacaatgtgagcttcaccatcaccaaccacagccaagtgaatgtgattcgc
ttcgagtggccccttttagctacactgtccttctccccacagattgggcatctccaccct
ggctgttccaaggacgtggtggtgaccttgaaatcagaatcacccatcaccctgaagaag
atgtgtgtcaagtgcaagctttccaagatcatgtttcagctccctgtagaccaggtccct
gactgggatgaccgcatgcgcacagtcaagtgggtggatgctccccgaaatacacctctg
accttgaatacaaaacgaaaggtcatagagatggaccctgagccagcccactcggtggta
gaagaaaattaccgagaattgcggatccagttcagtgccaatgtggattttgcttcatat
cagtgtgaaacaactgaagtgttctttaaggaaacactggtttaccagacccgagtgttt
gagtttgacctcgttaacacaggacaggtgctgttagaattctgctggatctcagaagaa
gcctccaaggcagtcagttttgccatgcctgagcgtcaaggttcaagtcaaaaagagcta
agtcagggctcaggcagctccctggacagtgccctggaccgctggaccgaagcctcgcca
tcacccttctcagtggaacccccctcaggcgttgtgcccgtaggaaagactcaaaagctc
aaagtgaagttctcgccaatggacatcggagagttcgagagctccttgtactgccaaatt
cccaacctcccacttggagaacaaggtcctattttgataacaaaagggcgaagcgtcctg
ccgttctgccactttgacctgaaggagtcggactacatcagtggtcatcggcgcaaccca
gagctccgaggaccaggcgctgggcctctcgaacctaatacccgtgtgattgagttcacc
agtgtgggcatcggtgggaagaatgtccagaccttcacaattctgaacccgaccaacagc
acctattctttctgctggacctctgaagagacggaaagtctccagcaccctccggccttt
gtgtgtcttacagaaaagggtatcatccaccctgagaagaaagctgagattatattccag
ttcctgccggctcacctggacatcacggaagagttctggactttctctatcccagagcat
aatatctcagtccccttcctgctggtgggcaagaccacagacccccttatctctcttgac
aagtctcacctcaatttcagctctctcctcattggcagagaagcccgagagacagtaaag
atcatcaacaaggaggagcaagggttcaatttcgccttccaggacaactcccgctattct
gaaggattcaacaacagcctcattgtatgccccatggaaggctggatcccgccactgtcc
aggttcccagttgatattttcttcacaccaaagcaagaaggagatgtgaacttcaatttg
atctgcaatataaaaaagaaagctcaccctctgacactcaacgtcaaggccgagggctac
actatgaatgctgaggtcaagtgcagagacaggatgggcaccaccatcctcctgacatcc
acccaggtcaacaccatcaacttctacgaggtggagttgaatgaatgtgttcagtgtgaa
ttcagtttcatcaacacgggcaagttcaacttcagctaccaggcagagctctctggacca
aaactcctgttgcaatacttggacttcacacccaccgacagtagcgtagacgtgggtcag
tctgaaccggccaacctgtcattccaaccgtatcagaagtgtgtcttgaagggcctggaa
ctcaaaatcaagatcagccatggcccaacattcgtatgcaacatcttaggctgtgctgtg
agcccagctgtccatttctccttcaccagccacaactttgggacttgcttcatctaccaa
gctgggatgcctccatataagcaaatcctcgttgtcaccaacaaagaagaaacatctatg
agcctagattgtttgtacaccaacaccccacacatcgaggtgaacttcaacgtggacgtg
ataaagccagggaagaccctggagatcccaatcaccttttaccctcgggaagctatcagc
taccgagaactcatcccctttgaaatcaatggactctctcaacagacagtggagatcaaa
gggaagggcacagaaatgaagcttttagtcctagacccagccaacaggatcgtgaagtta
ggagctgtcctgccaggacaggttgtgaggaaaacagtctccctcgtcaacaacagcctt
gcccagctcacctttaatcactcggtcctgttctctattccagagctccaggaagccaag
gtcatcaccttggagcccttccacacgatcaccatgaagcctaaagaagtctgtaaacta
gagattacctttgcccccaagaagcgagtccctcctttctctgaggaagtcttcatggaa
tggatggggctcctgcgtcctctcttcctcctcagtggctgttgtcaggccctggagatt
tccctggaccaagagcatcttccctttggccccgttgtgtatcaaactcaagccacgcgg
cgcattctcataatgaacacaggcgacgtgggtgcaaggtttaaatgggatgtcaagaaa
ctcaagccccacttctccattagccccgaagaaggctacatcatctcaggcacagaggtg
gctctagaagtaacataccaccccactgagatagggaaggagagtctctataaaaacatt
ctctgcttcatccaaggaggaaatcctctgtgcctcaccctgtctggaacctgtgtggga
ccacctgtggtaaaagaggtggtgaatttcaactgccaagtgcgctccaggcacacacag
accatcctgctctcaaaccgttccaaccagacctggaacctgcaccccatttttgagggt
gagcactgggaggggcccgagttcatcaccttggaggcccatcagcaaaacaagccctat
gagatcacctacaagccccgaaccatgaatctggagaatcgcaagcaccagggcactctc
tttttcccactccccgatgggactggctggctatatgccctgcacgggactgccgaactc
cccaaagctgttgccaatatctaccgtgaggttccatgtaagactccctataccgagctc
ctgccaatcagcaactggctgaacaagccccagagattccgggtcattgtggaaatattg
aaaccagagaagacagacctaagtgtcaccctgaagggccttgattacattgatgttctg
tctggctccaagaaagactacaagctgaacttcttttcctacaaggagggactgtacact
gcaaaggtgatcttccggaacgaggtgaccaacgagttcttatactatactgtgagcttc
agggtcaccccttctggcattataaaaaccatccagatgacaagcccagtccgccagagt
gtatcagcctccatcaagttggagaaccccctgccctactcagtgaccttttcaacagaa
tgcaagttgagtgacattagcctgccttcccagttcgctgtgcctccaaactctgaggga
acattctcatttgaattccagcccctgaaagctggagaactatgcgggagactgaccttg
cacaacagtgacttgggttactaccagtacgagctcgctctgaaggccttgcctgcacct
cccgagaaacccgtccacttccagaccgttcttggcagcagccagagcatcttagcaaag
ttcaccaattatacccggttgaagacagagtactactgcaagactgactgttctgacttc
cacacagaaaaagttattaacgcagccccaggagcccagggtggcactgaagtcagcgtg
gaagtcttctttgagcccagccatctgggtgagactaaaggcatcctgtgcctatcgtca
ctcataggtggggaatatatcatcccactctttggaattgctctgccccccaaaccccaa
ggtcccttcctaatcagagccggatacaacatcatcatccccttcaagaatgtcttcttg
catgcaacaagcttctccttcattgtggagaacccagccttcagcatccgggctgcagag
accgtgcggcccaagaagatcaacaacatcacagtctactttgaggggaacccgtcgggc
agtaaaaccccgatcacctctaagttgattgtcacctgccctcagtgtgaaggcaccgaa
tctggaatcaaatgggtttattatctgaaggggatcaccccttag

DBGET integrated database retrieval system