KEGG   Mus musculus (mouse): 244723Help
Entry
244723            CDS       T01002                                 

Gene name
Olfm2, A030009A06Rik
Definition
(RefSeq) olfactomedin 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: OLF Noelin-1 Helo_like_N ABC_tran_CTD PepSY_2 DUF1664
Motif
Other DBs
NCBI-GeneID: 244723
NCBI-ProteinID: NP_776138
MGI: 3045350
Ensembl: ENSMUSG00000032172
Vega: OTTMUSG00000062980
UniProt: Q8BM13
Position
9; 9 A3
AA seq 448 aa AA seqDB search
MRKLRQTGTTIAGGQTLFQSPEEGWQLYTSAQAPDGKCVCTAVIPAQSTCARDGRSRELR
QLMEKVQNVSQSMEVLELRTFRDLQYVRSMETLMRSLDARLRAADGSVSAKSFQELKDRM
TELLPLSSVLEQYKADTRTIVRLREEVRNLSGNLAAIQEEMGAYGYEDLQQRVMALEARL
HACAQKLGCGKLTGVSNPITIRAMGSRFGSWMTDTMAPSADSRVWYMDGYYKGRRVLEFR
TLGDFIKGQNFIQHLLPQPWAGTGHVVYNGSLFYNKYQSNVVVKYHFRSRSVLVQRSLPG
AGYNNTFPYSWGGFSDMDFMVDESGLWAVYTTNQNAGNIVVSRLDPHTLEVVRSWDTGYP
KRSAGEAFMICGVLYVTNSHLAGAKVYFAYFTNTSSYEYTDVPFHNQYSHISMLDYNPRE
RALYTWNNGHQVLYNVTLFHVISTAGDP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaactgagacagaccggaacaactattgctggaggtcagactctcttccagagc
ccggaggagggctggcagctttatacgtcagcccaggcacctgatggcaagtgcgtctgc
acagccgtgatccctgcgcagagcacctgtgcccgagacggtcggagcagagagcttcgg
caactcatggagaaggtccagaatgtgtcccagtccatggaggtccttgagctaaggaca
ttccgggatctccagtatgttcgcagcatggagaccctcatgcggagcctggatgcaagg
ctcagggcagccgatgggtcagtctcagccaaaagctttcaggaactgaaggacaggatg
acagagctgctgcccctgagttcagtgctggagcagtacaaagcagacacacgaaccatt
gtgcgcctgcgggaggaggtgaggaacctctctggcaacctggctgccatccaagaggaa
atgggtgcctacgggtacgaggacttgcaacagcgcgtgatggccctggaagcccgactc
catgcctgcgcgcagaagctgggctgcgggaagctgacaggcgtcagtaaccctattacc
atccgggccatggggtcccgcttcggttcctggatgactgacacaatggcccccagtgca
gacagcagggtctggtacatggatggttattacaaaggccgccgagtgctggagttccgt
actctgggagacttcatcaaaggccagaacttcatccagcacctgctgccacagccatgg
gcaggtacgggccatgtggtatacaatggctctctcttctacaataagtaccagagcaat
gtggtggtcaagtaccacttccggtcccgctcggtgctggtgcagaggagcctcccgggg
gctggttacaataacaccttcccctattcctggggcggcttctcggacatggacttcatg
gtagacgagagtgggctgtgggctgtgtataccaccaaccagaatgcgggcaacatcgta
gtcagtcggctggaccctcacaccctggaggtcgtgagatcctgggacaccgggtaccct
aagcgcagcgccggcgaggccttcatgatctgcggtgtcctctatgtgaccaactctcac
ctggccggagccaaggtctactttgcgtacttcaccaacacgtccagctatgagtacacg
gatgtgcccttccacaaccagtattcgcacatctcgatgctggattacaaccccagggag
cgggccctgtatacctggaacaacgggcaccaggtgctgtacaacgtcaccctgttccac
gtcatcagcactgccggggacccctag

DBGET integrated database retrieval system