KEGG   Mus musculus (house mouse): 244867
Entry
244867            CDS       T01002                                 
Symbol
Arhgap20, 6530403F17Rik, A530023E23Rik, RARhoGAP, mKIAA1391
Name
(RefSeq) Rho GTPase activating protein 20
  KO
K20641  Rho GTPase-activating protein 20
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    244867 (Arhgap20)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    244867 (Arhgap20)
SSDB
Motif
Pfam: RhoGAP RA PH_19
Other DBs
NCBI-GeneID: 244867
NCBI-ProteinID: NP_780744
MGI: 2445175
Ensembl: ENSMUSG00000053199
Vega: OTTMUSG00000024028
UniProt: Q6IFT4
Position
9:51676651..51765158
AA seq 1182 aa
MEAMSPQQDALGAQPGRSSSLTGMSRIAGGPGTKKKMKTLAERRRSAPSLILDKALQKRP
STRDSHSASIDTCAFLSSFMCSSRTLLIDGPVELKRGLQRQERHLFLFNDLFVSAKIKYN
NNFKIKNKIRLTDMWTASCVEEVGEGNMNAQKSFVLGWPTVNFVATFSSPEQKDKWLSLL
QRYIALEKEKDYPKSIPLKIFAKDIGNCAYFKTITVMNSDTASEVINMSLQMLGITGSER
DYQLWVNSGKEAAPYPLIGHEYPYGIKMSHLRDTALLTQGSRDSASPSQLQEPFLMEQLP
REMQCQFILKPTRLATAQQLSDSSQKTFKRRRSIINWAFWRGSSTHLDNLPMSPTSPMPG
QLFGVSLPDLCENDNLPKPILDMLSFLNQKGPLTKGIFRQSANMKSCRELKEKLNSGIEV
HLDCESIFVIASVLKDFLRNIPESIFSSDLYDHWVCVMDQGNDEEKINIIQRLLDQLPRA
NVVFLRYLFGVLHNIEQHSLSNQMTAFNLAVCIAPSILWPPASSSPELENEFTKKVSLLI
QFLIENCCRVFGEEIASLLGELSERSDREHTPDITCFQMNDSSYDSLENELNEEADAPCS
DLVKKLGQGSRSMDSVLTLSDYDLEQPEVEGLLTLSNFDLDQSKEEHIPIKPPLEPKPVN
VFVGYRKVSLGEHARAPAGPGTLSCLPVAAADAPKVLRRHRRSSEPSIDYLDTKLSYLRE
FYQKKLRKSSCDAVLSRKDEDYLKQTQPQKKGDKVCLKQSSVTGTDVSKRNTANENIKKK
SLSGHEGTQVTLFTKSKPVPISVASYSHGSSQDHPRKQAFDADPCRFSPPHLTDAQKSSR
VQHRRCSEPSIDDQNYKLSYLRGIYSMKQNKASCEAGLLHGEDDYLRRHKSLQIEGQKLI
NQSLVMGIEVGKSSSSHQSTEKVLPPRLNLCPRASYSSLSSPGSSPSGSSVSSQDSAFSQ
ISEHSVFTPTETSSPIDCTFQTQRKQEELSSDFDSPSRLSGMPGPSMGQASSHLAYLRKG
TTEQPSQMHSVTLHPSAWLRSGLVTLKNWSLKKKTKAARPEDRKVCSLKEPLELPSCASG
TPEADSLQESQDDLQGDEGPGQTACGFSSYACQDSEQHAGSPFHLAESRLKPCMKLYKGE
ESGGQYPCDNPWEGASSSLETTEDTANPGAEPTTFAMTGTDI
NT seq 3549 nt   +upstreamnt  +downstreamnt
atggaagcgatgtctccgcagcaggatgctctaggggcgcagccggggcgctcctcctcg
ctgacaggcatgtctcgcatcgcgggaggccctggcaccaagaagaaaatgaaaacactc
gcagaaaggaggagaagcgccccgtccctcatcctggacaaagccttacagaagcggccg
agcaccagagacagccattctgccagcattgacacgtgtgcattcctctcgtccttcatg
tgctccagtcgcactctgctgattgatggtccagtggaacttaaaagaggcctgcagagg
caggagaggcatcttttcctattcaacgatctgtttgtctcagccaaaatcaaatataac
aacaactttaagataaagaataaaataagactaactgacatgtggacagctagctgtgtg
gaggaagtgggagaaggcaacatgaatgctcagaagtcctttgtcctgggctggcccacc
gtgaactttgtggctactttcagttctccagaacaaaaggacaaatggctgtctctcctt
cagagatacatcgctctagaaaaggagaaagactacccgaagagcatccccctcaaaatc
tttgccaaggacattggaaactgtgcctattttaaaactataacagtgatgaattcagac
acagcgagtgaagttatcaacatgtcactgcaaatgttaggaataactggctctgagaga
gattaccaactgtgggtaaattctggaaaagaagcggcaccgtacccactcattggacac
gagtatccttatggaattaaaatgagccacctccgagacactgcccttctgacgcaggga
tcaagagactctgccagcccatcccagctccaagagcctttcctcatggagcagctgccc
cgcgagatgcaatgccagttcatcctgaaacctacccgcctggcgacagcccagcaactg
agcgattccagccagaagacatttaaaaggaggcgctctatcatcaactgggctttttgg
cggggttctagcacacacctggacaacctgcccatgtcaccaacatcccctatgccagga
cagctctttggagtttctttaccagatctttgtgagaacgacaatctgccaaagcctatc
ttggatatgctttccttccttaaccaaaaaggccccctcacaaaaggcatcttcaggcag
tcggccaacatgaaatcttgcagagagctaaaggagaaactgaattctggaatcgaagtc
caccttgactgtgaatccatctttgtgatagcatctgtgttgaaggattttctgagaaat
atcccagaaagtatcttttcatcagatctatatgatcactgggtctgtgtaatggatcaa
ggaaatgatgaagaaaaaataaatataattcaaaggctattagatcagcttcccagagcc
aatgttgttttcctaaggtatctgtttggggtattacacaacattgaacaacattccttg
tctaatcagatgactgcatttaacttagcagtgtgtatcgctccaagcattctttggcct
cctgcttcctccagtccagagctagaaaatgaatttacaaaaaaggtttctcttcttata
caatttctgattgaaaactgctgtagggtatttggagaagaaatcgcttctctcttgggg
gagctttcggagagaagcgacagagaacacaccccagatataacttgcttccaaatgaac
gactcctcctatgacagcttggaaaacgagctcaatgaggaagctgatgctccatgcagt
gacctggtcaaaaagcttggccagggtagcaggagcatggactctgtcttaaccctcagc
gactatgaccttgaacagcctgaggtggaaggcctcttaaccctgagcaactttgactta
gatcagtctaaagaggagcacattccgataaagccacctctggagcccaagccagtgaat
gttttcgtaggctacaggaaggtttcactaggggagcacgctagggccccagctggccca
ggcacactcagctgcctgcctgtggctgcagcagatgccccgaaagtcctgcggcggcac
cggcgctcctcagaacccagcattgactatctagacacaaagctttcctatctccgggag
ttttaccagaaaaagctgcgcaagtccagctgcgatgctgtcctctctagaaaagatgaa
gattacctgaagcagacccagcctcagaagaaaggggataaggtgtgtcttaaacagagt
tcagtgacaggcactgacgtcagcaagagaaacacagctaatgaaaacattaagaagaaa
agcttgtctggtcatgaaggaactcaagtgacactttttactaagtccaagccagtaccc
atctctgtggcatcttacagccacgggtcctcccaggatcatcccaggaagcaagccttt
gatgcagacccatgccggttctccccaccacacctaacagatgcccaaaagagctcaagg
gtgcaacatcggcgctgttcagaacccagcatagatgaccagaactacaagctgtcctat
ctcagggggatctattcaatgaaacaaaataaagccagctgtgaggctggcctcttgcat
ggggaggacgactatctcagaaggcataagtctttgcaaatcgagggccaaaagcttatt
aatcagagtttggtcatgggcattgaggtgggcaagagcagcagctctcaccaaagcact
gagaaggttttgcccccaagactaaacctttgcccaagggcaagctattcaagcttatct
tctccaggctcgtccccatccggctcctctgtaagctcccaggacagcgctttctctcag
atctctgaacactccgtgtttacgcccaccgaaacctcctcaccaatagattgcactttc
cagacacaaagaaaacaagaagagctgtcttcagactttgacagtcccagccgcctttcc
ggaatgcccggtccctccatgggtcaggccagcagccacctagcttatttaagaaagggt
accacggagcagccatcacaaatgcattctgtaacccttcaccccagtgcgtggttgaga
agtggcttggtcactttaaaaaactggtccctcaaaaagaaaacaaaagcagccagacca
gaagacaggaaagtctgttccctgaaagagcctctggagttgccgtcatgtgcttccggt
accccagaggctgactctctacaagagagtcaggatgacttacagggagatgaaggacct
gggcaaacagcctgtggattcagttcttatgcctgtcaggactcagagcaacatgccggc
tctccattccacctggcagaaagcagactcaagccttgtatgaagttatataagggagaa
gagagtggagggcagtacccttgtgataacccttgggaaggagcctcttcaagtctggag
accacggaggatacagccaacccaggtgcagaacctacaacatttgcgatgacggggaca
gatatttaa

DBGET integrated database retrieval system