KEGG   Mus musculus (mouse): 244882
Entry
244882            CDS       T01002                                 

Gene name
Tnfaip8l3, 9930029P06Rik, Gm517
Definition
(RefSeq) tumor necrosis factor, alpha-induced protein 8-like 3
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: DUF758 PFO_beta_C DUF2408 Skp1 TPX2
Other DBs
NCBI-GeneID: 244882
NCBI-ProteinID: NP_001028707
MGI: 2685363
Ensembl: ENSMUSG00000074345
Vega: OTTMUSG00000063198
UniProt: Q3TBL6
Position
9; 9 A5.3
AA seq 204 aa
MDSDSGEQSEGEPGTAAGPHVFSSKNLALQAQKKILSKIASKTVANMLIDDTSSEIFDEL
YKVTEIHTHNKKEAHKIMKDAIKVAIKIGILYRNKQFSQEEVIIVEKLRKKLNQTAMTMV
SFYEVEYTFDTNVLSKLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYGP
HGNCRPNLKRICEGINKLLDDKIL
NT seq 615 nt   +upstreamnt  +downstreamnt
atggattcagattctggagagcagagcgagggcgagcccgggactgctgcaggtcctcat
gtgtttagttccaagaatctcgcccttcaagcccagaagaagatcctgagcaagatagcc
agcaaaactgtggccaacatgctgattgatgacaccagcagtgagatctttgatgagctg
tacaaagtcacagaaatacacacccacaacaagaaggaggcccacaagatcatgaaggat
gctatcaaggtggcaatcaaaattggcattctctaccggaacaaacagttcagtcaagag
gaggttataattgtggagaaactccggaagaaactgaaccagactgcgatgaccatggtc
agcttctacgaagtagagtatacctttgatacgaatgtgctctctaagcttctgcatgag
tgcaaggacctggtacatgaactggtacagcgacacttgacacccagaacccatggacgc
ataaaccatgtcttcaaccactttgctgatgtggaattcctttccactctctatggtccg
catggaaactgcaggcccaatctcaagaggatttgcgaaggaatcaataaattgttagac
gacaagatcctctga

DBGET integrated database retrieval system