KEGG   Mus musculus (mouse): 245000Help
Entry
245000            CDS       T01002                                 

Gene name
Atr
Definition
(RefSeq) ataxia telangiectasia and Rad3 related
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03460  Fanconi anemia pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04218  Cellular senescence
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    245000 (Atr)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    245000 (Atr)
   04115 p53 signaling pathway
    245000 (Atr)
   04218 Cellular senescence
    245000 (Atr)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    245000 (Atr)
   05170 Human immunodeficiency virus 1 infection
    245000 (Atr)
   05165 Human papillomavirus infection
    245000 (Atr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    245000 (Atr)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    245000 (Atr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     245000 (Atr)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   245000 (Atr)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    245000 (Atr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT UME FATC IFRD Mad3_BUB1_I THP2
Motif
Other DBs
NCBI-GeneID: 245000
NCBI-ProteinID: NP_063917
MGI: 108028
Ensembl: ENSMUSG00000032409
Vega: OTTMUSG00000047295
UniProt: A0A1L1SSL9
Position
9; 9 E3.3
AA seq 2641 aa AA seqDB search
MGDHGLELASMIPALRELASATPEEYNTVVQKPRQILCQFIDRILTDVNVVALELVKKTD
AQPTSVMLLDFIQHIMKSSPLMFVNVNGSQGQNEAKDSCIEFSHWIITRLLRIAATPSCH
MLHKKICEVICSLLFLFKSKNPAIFGVLTRELLYLFEDLIYLHKRNAVGEVMEWPVVVSR
FLSRLDEHMGCLQPAPLQFMNVQNVEFIEVTLLMVLIHIVPTVFFRRQELLLWQIGCALL
EHGSPKIRSLAISLLTELFELGGLPAQPASTFFSLFLELLQHLVGMDADQLKLYEEPLSK
LLKTLFPFEAEAYRNIEPVYLNVLLEKLSVMFEDRVLMRLKSDLLKAALCHLLQYFLTFV
PAGYESALQVRKVYVTNICRALVDALGVQKHVGYLLGPFYAALKMESKEIIERIQCQAQQ
ENLSGNNDEVSPKRRKLSSSLSSYKKPSRQPEEIIHVDMDKKSILWNVLKQKAESLQISL
ECGTLKNSVAEALEGITVVLQLTALCTVHCSHQDMDGHNVKDHQHKYKKKPPVVVTWMSL
DFYTKVLKSCRSLLESVQKLELELVIDSMVRICDALMYMQVKSSFKDHVLEELCGMLSLP
WIYSYSDDNSLKMTTFATNLLPLSQRVWDSYSPQAQSKCVFLLTLFPRRIFLEWRTAVYN
WALKSSHEVIRASCVKGFFILLHQQNSCNQIPKMLVDRVKDDSDMVKKEFASVLGQLVCT
LHGMFYLSSSVEPCFEHMDLFSKNLKATSQHECSSSQVKASTCKPFLFLLTKNTPSPVKL
AFIDNLHHLCKHLDFQEDEREVKAVLGTLLNLMEDPDKDVRIAFSGNIKYILESLNSEDG
FVKELFVLRMKEAYTHAQIARNNELKDTLILTTGDIGRAAKGDLIPFALLHLLHCLLSKS
ASVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQFLVESLHSSQMTALPSAPCQSSEIR
KQDVAHHREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQ
LNVSRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNELL
LRIGEHYQQVFNGLSILASFASSDDPYQGPRDITSPELMADYLQPKLLGILAFFNMQLLS
SSVGIEDKKMALTSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFV
RCLDHAYLGPLLSHVIVALLPLIHMQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHPE
LEKIKAVLQEYRKETSETTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIK
YATDSETVEPVISQLVTVILKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGKD
FTFVTGVEDLSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMQSNGPGY
QLWKRFPEHVREILEPHLNTRYKSSQKSTDWSGVTKPIYLSKLGNNFAEWSSSWAGYLIT
KVRDNLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHDE
QHAISTQDSASDLCQLSTQTVFSVLDHLTQWARHKFQALNAEKLAQNKPKGGKVNKILSN
VNFEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQKHLGFLQKLY
AAMHEPDGVAGVSAIRKAEPSLKEQILEHESIGLLRDATACYDRAIQLEPDQIIHYHGVV
KSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTW
SVRLGQLLLSAKKRDTTTFYDTLKLVRAEQIVPLSAASFERGSYQRGYEFIVRLHMLCEL
EHSLKPLFRKSPGDSCNEDSLNWGARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMV
GECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGV
ELCFPENKSPSESKHMLIHGRATLLVGRFMEETANFESNAVMKKYKDVTLFLPEWEDGHF
YLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLSLWLDFGAK
AYEWEKGGRSDRLQMRNDLAKINSVLTEHTNRLAPYQFLTAFSQLISRICHSHDEVFVVL
MEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILTKAIHMKKSLEKFVGDATRLTD
KLLELCNKSVDGSNSTLSMSTHFKMLKRLVEDPTFSEILIPLQSVMIPTLPSVLGAHANH
DPFPGHWAYLAGFDDVVEILSSLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNS
LINKSLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKIYKEKGVYMTG
KELRQCMLPKSAALSEKLKVFQELLLPRHPPVFHEWFLRTFPDPTSWYSSRSAYCRSTAV
MSMVGYILGLGDRHGENILFDSFTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGM
GPMGTEGLFRRACEVTLRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEV
VNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPY
M
NT seq 7926 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaccacgggctggagctggcgtccatgatccccgccctgcgggagttggccagt
gctactccagaagaatataacactgttgtacagaaaccaagacagattctctgccagttc
attgacagaatacttacagatgtaaatgttgttgctctagaacttgtaaagaaaactgac
gctcagccgacctctgtgatgttacttgattttatccagcacatcatgaagtcttctccg
cttatgtttgtaaatgtgaatggaagccagggccaaaatgaggccaaagacagttgtatt
gaattcagtcattggatcattacaagacttttacggattgcagcaactccatcctgccac
atgctacacaagaaaatatgtgaagttatctgctcgttattatttctttttaaaagcaag
aatcctgctatttttggggtactcacaagagaattactttatctttttgaagacttaatt
tacctccacaaaagaaatgcagtgggtgaggttatggaatggccagtggttgttagtcgg
tttttaagccgattggatgaacatatgggatgtttacagccagctcctttgcagttcatg
aacgtgcaaaatgtagaatttattgaagtcactctattaatggttcttattcatattgtt
ccaaccgtgttttttagacgacaagaattgttactgtggcaaatcggctgcgctctgcta
gagcacggtagtcccaaaatcaggtctttagcaattagccttctaactgagctctttgag
cttggagggttaccagcacagccagccagcacttttttcagcttatttttggagttgcta
caacaccttgttggaatggatgctgaccaattgaaattgtatgaagagccattgtcaaag
ctgctaaaaacgctctttccctttgaagcagaggcttatagaaatattgaacctgtctac
ttaaatgtgctactggaaaaactcagtgtcatgtttgaagatcgcgtgcttatgcggctc
aagtctgatttgctgaaggctgctttgtgtcatttactgcagtatttccttacatttgtg
ccagctgggtatgaatcggctttacaggtcaggaaggtttatgtgacaaatatttgtaga
gctcttgtagacgctcttggagttcagaaacatgttgggtatttgttgggaccattttat
gcagccttgaaaatggaaagtaaggaaattattgaaagaattcaatgccaagctcaacag
gagaatctcagtggtaataatgatgaggtgtcaccaaagaggcgtaaactcagctcctct
ctcagctcttacaaaaagccatccagacagcctgaagaaattattcatgtggatatggac
aaaaagagcatattatggaatgttctgaaacagaaagccgaatcccttcagatctctctc
gaatgtggtactctcaagaattctgttgctgaggcattagaaggaatcactgttgtatta
cagctgactgctctctgcactgttcactgttctcatcaagacatggatggccataatgtc
aaggatcatcaacacaaatataagaagaaacctccagtagtagtaacttggatgtctttg
gatttttatacaaaagtgcttaaaagctgtaggagtttgttagaatctgttcagaaactt
gaactggaattagtcattgatagcatggtgagaatttgtgatgctctgatgtatatgcaa
gtaaaaagttcattcaaggatcatgttctggaagagttatgtggaatgctctcacttcca
tggatttattcctattctgatgataactctttaaagatgaccacatttgctactaacctt
ctgccattaagccagagggtttgggatagttactctccacaggcacagtcaaaatgtgtg
tttcttctgacactgtttccaagaagaatattccttgaatggagaacagcagtttataat
tgggccctaaagagctcccatgaagtaatccgggctagttgtgttaaaggattttttatc
ttattgcatcagcagaattcttgtaaccaaattcccaagatgcttgtagatagagtcaaa
gatgattctgacatggtcaagaaagaatttgcttctgtccttggtcaacttgtctgtact
cttcacggcatgttttatttgagttcctcagtagagccttgctttgaacatatggacttg
ttcagtaagaacctgaaagccacttctcagcatgaatgttcatcttctcaagtaaaagct
tccacttgcaagccattccttttcctgctgaccaaaaatacacctagtccagtaaaactt
gctttcatagacaatctacatcatctttgtaagcatcttgattttcaagaagatgaaaga
gaggtaaaagcagttcttgggactttattaaatttgatggaagatccagacaaggatgtt
agaattgcttttagtggaaatatcaagtatatattggaatccttgaactctgaagatgga
ttcgtaaaagagctttttgtcttaagaatgaaggaagcatatactcatgcccaaatagca
aggaataatgagctaaaggatactttgattcttacaacaggggatattggaagggcagca
aaaggagatttgatacctttcgcactcttgcatttactgcattgcttgctgtctaagtct
gcatccgtctctggagcggcatacacagagattcgagcactagttgcagctaaaagtgtt
aaactgcagaattttttcagtcaatataagaaaccgatctgtcagtttttggtagaatct
ctccactccagtcagatgacagcactcccaagtgctccttgccagtcttctgagattcga
aaacaagatgttgctcatcacagagagatggctttaaataccttatcagaaattgccaat
gtttttgactttcctgatcttaatcgtttcctgacaaggacattacaagttctgcttcct
gatcttgctgccaaagcaagtcctgcagcatcggctctcattcgaactttagggaaacaa
ttaaatgtcagtcgtcgagagattttaataaataacttcaaatacatcttttcccatttg
gtttgttcttgttccaaagatgaattagaacgtgctcttcattatctgaagaatgaaaca
gaaattgagttggggagcctgttaagacaggattttcaaggattgcataacgaattattg
ctgcgtattggagaacattatcaacaagttttcaatggtttgtcaatacttgcctcattt
gcatctagtgatgatccatatcagggaccacgagatattacatcacctgaactgatggct
gattatttgcaaccaaaattgttgggcattctggccttttttaatatgcagttgctgagc
tccagtgttggcattgaagataagaaaatggccttgactagtttgatgtctttgatgaag
ttgatgggacctaaacatgtcagttctgtgagagtaaaaatgatgaccacactgagaact
ggtcttagattcaaggatgattttcctgagttatgctgcagagcatgggactgctttgtt
cgctgtctggatcacgcttacctgggacccctgctcagtcatgtcatagtggctttgtta
cctctcatacacatgcagcctaaagaaactgctgctatctttcactacctcatcattgaa
aacagggatgctgtgcaagattttcttcatgaaatatattttttgcctgatcatccagaa
ttagaaaagataaaagcagttctccaggaatatagaaaggaaacctctgagactactgat
cttcaaaccactctccagctatctatgaaagcaattcaacacgaaaatgtagatgttcga
attcatgctcttacaagcttgaaggaaaccttgtacaaaaatcaggaaaaactgataaaa
tatgcaactgatagtgagacagtggagcccgttatctcccagcttgtgacggtaattctg
aaaggctgccaagatgcaaactctcaagctcgcttactctgtggggaatgtttaggagaa
ctgggggcaatagacccagggcgattggatttctcaacaacagaaactcaaggaaaagat
tttacatttgtgactggagtagaagatttaagctttgcctatggattgctaatggagcta
acaagagcttaccttgcatatgctgataacagccgagcacaagattcagctgcttatgct
attcaggagttgctttctatttatgactgtagagagatgcagagcaatggcccaggttac
cagttgtggaaaagattccctgagcatgtccgggaaatattagagcctcatctcaatact
agatataagagttcccagaaatcaacagattggtctggagtaacgaagccaatttactta
agtaaactaggtaataactttgcagaatggtcatcatcttgggcaggttatcttataaca
aaggttcgggataatcttgccagtaagatcttcacatgctgtagcataatgatgaagcat
gattttaaagtcaccatctatcttcttccacatatcctagtatatgtcttgttgggttgt
aatcaagaagatcagcaagaggtttatgcagaaattatggcagtacttaagcatgatgag
cagcatgccatcagtacccaagacagtgcatctgatctgtgccagctgagtacacagact
gtgttctctgtgcttgaccatctcacccaatgggcaaggcacaaatttcaggcattgaat
gctgagaaacttgcacaaaacaaaccaaaaggaggtaaggtcaacaaaatattatcaaat
gtgaattttgaagactatcagagtgtaactcgttttctagacctcatacctcaggatact
ctggctgtagcgtcctttcgttccaaagcatacacacgagccgtaatgcactttgagtca
tttattacagaaaagaagcaaaatattcaaaagcatcttggatttctacagaaattgtat
gctgctatgcatgagccagatggagtggctggagtaagtgcaattcggaaagccgagcca
tccctgaaggaacagattcttgaacatgaaagtattggcttgctgagggatgccactgcc
tgttatgacagggctattcagctagaaccagaccagatcattcattatcatggtgttgtg
aagtccatgttaggtcttggtcagctgtctactgttatcacccaggtcaatggagtacat
gctaataggtctgaatggacagatgaattaaacacatacagagttgaagcagcttggaaa
ctgtcacagtgggatttggtggaaaactatttagcagcagacgggaaatccacaacatgg
agtgtcagactaggacagctactgttatcagctaaaaagagagacaccacaactttttat
gacacactgaagctagtgagagcagaacaaatcgtacctctctcagctgccagctttgaa
agaggctcctaccaacgaggctatgagtttattgtcagattacacatgttgtgtgagttg
gagcacagcctcaaaccgctttttcgcaagtctccaggtgacagttgtaatgaagactct
ctgaactggggagctcgacttgaaatgacccagaattcctatagagccaaggagcctatc
ctggccctccggagggctttattaagtctcaacaaaaggccggattacaatgaaatggtt
ggagaatgctggctacagagtgccagggtagctagaaaggctggccaccatcagacagcc
tacaatgctctccttaatgctggagagtcacgacttgctgaactgtatgtggagagggca
aagtggctgtggtccaagggtgacgttcaccaggcgcttattgttcttcaaaagggcgtg
gaattatgttttcctgaaaataagtccccatctgagagtaagcacatgctaatccatggc
cgggccacactgctagttggccgctttatggaagaaacggctaactttgaaagcaacgca
gtaatgaagaaatacaaggatgtgaccttgtttctgccagagtgggaagatggacatttc
taccttgccaagtactatgacaaattgatgccgatggtaacagataacaaaatggaaaag
caaggtgatctcatccgatatatagttttacattttggaagatctcttcagtatggaaat
cagttcatatatcagtcaatgccacgaatgttatcgctatggcttgattttggtgctaag
gcatacgaatgggaaaaaggtggtcgttctgatcgtctgcaaatgagaaatgatttggct
aaaataaatagtgtactcacagagcacacaaatcggttagcaccatatcagtttttgact
gctttttcgcagttgatctctcgaatatgtcattctcatgatgaagtttttgttgtcttg
atggaaataatagccaaggtatttctggcctatcctcagcaagcaatgtggatgatgact
gctgtgtcaaagtcttcttatcccatgcgtgtgaacagatgcaaggaaattcttaccaaa
gccatccatatgaaaaagtctttagaaaagtttgttggagatgcaactcgtttaacagac
aagctactagaattatgcaacaaatcggtcgatggaagcaattccacattaagcatgagc
actcactttaaaatgcttaaaaggcttgtagaagacccgaccttcagtgagatcctcatt
cccctgcagtcagtcatgatccctactcttccgtcagttctgggtgcccatgcgaatcat
gacccctttcctgggcactgggcctatcttgcaggcttcgatgatgtggtagaaattctt
tcttctcttcagaaaccaaagaaaatctctttaaagggctcagatggaaagttctacatc
atgatgtgtaaaccaaaagatgacttgagaaaagactgtagactaatggaattcaactct
ttgattaacaagagcttaagaaaagatgcagaatcacgtcgaagagaacttcatatccga
acatatgcagttattccactgaatgatgaatgtgggattattgaatgggtgaacaatact
gctggcttgagacctattctgaccaaaatatataaagaaaagggagtgtatatgacagga
aaggagcttcgccagtgtatgctaccaaagtcagcagctttatctgaaaaactcaaagta
ttccaagaattactcctgcccaggcatcctcctgtttttcatgagtggtttctgagaaca
ttccctgatcctacatcatggtacagtagcagatctgcatattgccgctctactgcagtc
atgtcaatggttggctacatcctggggcttggagaccgtcatggtgaaaacattcttttt
gactctttcactggtgaatgtgtacatgtagatttcaactgtctttttaataagggagaa
acgtttgaagttccggaaattgtaccatttcgactgactcataatatggttaatggaatg
ggtcctatgggaacagagggtctatttcgaagagcatgtgaagttacactgagactgatg
agggatcagagagaacctttaatgagtgtcttaaagacttttctacacgatcctctagtg
gagtggagtaaaccagtgaaaggacactccaaagcaccactgaatgaaaccggggaagtt
gtcaatgagaaggccaagacccatgttcttgacattgaacaacgactacaaggtgtgatc
aaaacccgaaatagagtaacagggctgccattatctattgaaggacatgtgcattacctc
atacaagaagctactgatgaaaacttactctgtcagatgtaccttggttggaccccatat
atgtaa

DBGET integrated database retrieval system