KEGG   Mus musculus (mouse): 245282
Entry
245282            CDS       T01002                                 

Gene name
Apol10a, 9030421J09Rik
Definition
(RefSeq) apolipoprotein L 10A
  KO
K14480  apolipoprotein L
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    245282 (Apol10a)
Motif
Pfam: ApoL
Other DBs
NCBI-GeneID: 245282
NCBI-ProteinID: NP_808412
MGI: 3036238
Ensembl: ENSMUSG00000050982
Vega: OTTMUSG00000028116
UniProt: Q8CCA5
Position
15; 15 D3
AA seq 318 aa
MDWNEILEDIRKVERRIVEKFIEDLTENFLRTDLRSLITEDGAWNGFLETAELSSEEKAA
LRDALKESSAQKPSGENDRPERKPQKEQILREVPQLKKKLEVHISKLRELADKLDLVHKC
CTISNVVSLTLSAASGVLKLLDFVLSQIYGMPRRALSATSEGLGMASDMINITTTIVGES
FRQSYESEARRLVGASINILYEIINITPMITVKLYYTVKDLVEAFKTLTGQIRAIRTAIS
NSDLGTQARNPASTGRSSGQGVPQMISRARIREIGLTVPFLEQDLRDLAQQFEVLKDGAK
TESGGALRDLAHKLEENL
NT seq 957 nt   +upstreamnt  +downstreamnt
atggattggaatgagatcttagaggacattaggaaagtggaacgtcgcattgttgaaaaa
ttcattgaagatctcacagaaaatttcttaagaacagatctgaggagccttataactgaa
gatggagcctggaatggatttttggaaacagcagagttgtcaagtgaggagaaagctgca
ctgcgtgatgctctgaaggagagttcagcacagaagccctctggtgaaaatgacagacct
gaaaggaagccacagaaagagcagattttgcgagaggttcctcagttgaagaagaaactt
gaggtccatatcagtaagctccgagagctggctgacaaacttgacctggtgcacaagtgc
tgcaccatctccaatgtggtgtccctcactcttagtgctgcttcaggagtcctcaagctc
cttgattttgttctgtcacagatctatggaatgcccaggcgagcactctcagcaacctct
gagggtctgggaatggcatcagatatgattaatattactaccaccattgtgggagaaagt
ttcagacagtcatatgaatcagaagccagacgcctggttggagccagcataaatatactt
tacgagattataaatatcactcctatgatcacagtcaagctttattatacagttaaggat
ttagttgaagccttcaaaaccctcacgggtcagatccgagccatcaggacagccatatcc
aactctgaccttggaacacaggccaggaaccctgcatccactggaagaagctctggacag
ggtgtcccccagatgatcagtagagccaggattagagaaatagggcttacagttccgttc
cttgaacaggatcttcgggaccttgcgcaacaattcgaggttttgaaggatggggcaaaa
acagagtcaggtggagcactgcgggacctggctcacaagctggaggagaacctttag

DBGET integrated database retrieval system