KEGG   Mus musculus (mouse): 245446Help
Entry
245446            CDS       T01002                                 

Gene name
Slitrk4, 6430513G13, D930039I09Rik
Definition
(RefSeq) SLIT and NTRK-like family, member 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 TPKR_C2 LRRNT LRR_1
Motif
Other DBs
NCBI-GeneID: 245446
NCBI-ProteinID: NP_848855
MGI: 2442509
Ensembl: ENSMUSG00000046699
Vega: OTTMUSG00000017598
UniProt: Q810B8 Q149A4
Position
X; X A7.1
AA seq 837 aa AA seqDB search
MFLWLFLIVSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSN
FYHLNFQNNFLNILYPNTFVNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELK
ILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASL
THLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEA
ICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQQENGFTTPNGHTTQTTLHRLV
TKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPVPCFCKTHPSDLGLSVN
CQEKNIQSMSELTPKPLNAKKLHVNGNNIKDVDISDFTEFEGLDLLHLGSNQITLIKGEV
FHNLTNLRRLYLNGNQIERLYPEIFSGLHNLQYLYLEYNLIKEILAGTFDSMPNLQLLYL
NNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLV
ALKLWLEKLNDGIVVKELKCETPVQFANIELKSLKNEILCPKLLNKPSATFTSPAPAITF
TTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNSE
CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVM
MRNAADKDKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYNSIGVSGFEIR
YPEKQQDKKNKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttggctctttctgattgtgtcagccctgatttcttctacaaatgcagattct
gacatatcagtggaaatttgcaatgtgtgttcctgcgtgtcagtagagaatgtgctctat
gtcaactgtgagaaggtttcagtctacaggccaaaccagctgaaaccaccttggtctaat
ttctatcatctcaatttccaaaacaattttttaaatatcctctatccaaatacattcgtg
aatttttctcatgcagtatctctgcatctgggaaataataagctgcagaacattgaggga
ggagcctttctcgggctcagtgcattaaagcagttgcacttgaacaacaatgaattaaag
attctccgagctgacactttccttggcatagagaacttggagtatctccaggctgactac
aatttaatcaagtatattgaacgaggagccttcaataagctccataaactgaaagttctc
attcttaatgacaatctgatttcattccttcctgataatatttttcgatttgcatcttta
acccatttggatatacgaggaaacagaatccagaaacttccttatattggagttctagaa
cacattggccgggttgttgagttgcagctggaagataatccttggaactgtagctgtgat
ttgttgcctctaaaggcttggctggagaatatgccatataacatttacataggagaagct
atttgtgaaactcccagtgacttatatggaaggcttttaaaggaaaccaacaagcaagaa
ctatgccccatgggtacaggcagtgactttgacgtacgcattctgcctccatctcagcag
gagaatggctttactactcccaatggtcacactactcagacaaccttgcacagattagtg
acaaaaccacccaaaacaacaaatccttccaaaatctctggaattgtggcaggcaaagcc
ctatccaacagaaatctcagtcagattgtgtcatatcaaacaagagtgcctcctcttaca
ccttgtccagtaccttgcttttgcaaaacacatccttctgatttgggattgagtgtgaat
tgccaagagaaaaatatacagtccatgtctgaattgacaccaaaacctttgaatgccaag
aagttgcatgtcaatggtaataacatcaaagatgtggacatttcagacttcactgagttt
gaggggctggatttgctccatttaggcagcaatcagattacgttgatcaaaggagaagta
ttccacaatcttactaatctgcgcaggctttatctcaatggcaatcagattgaaaggcta
taccctgaaatattttcaggacttcataacctgcagtatctttatttggagtacaacttg
attaaggaaattttagcaggcacctttgactccatgccaaatttgcagctactgtacttg
aacaataatctcttaaaaagcctgccagtttacatcttttctggagcaccacttgctaga
ctgaacctgagaaacaacaaattcatgtacctacctgtcagcggagtacttgatcagttg
cagtctcttacacaaattgacttagagggcaacccttgggactgcacctgcgacttggta
gcattaaagttgtggctggagaagttaaatgatgggattgttgtgaaagaactgaaatgt
gagactcctgttcagtttgccaacatcgaattgaagtccctcaaaaatgaaatcttatgc
cctaaactcttaaacaagccatcagcaacattcacaagccctgcgcctgcaattaccttc
accactccattgggtcctattcgaagtcctcctgggggcccagtgccattatctatttta
atcttaagtattctggtggttctcattttaactgtctttgttgcattttgccttcttgtt
tttgtgctgagacgtaacaagaaacccacagtgaagcatgaaggtctggggaattctgag
tgtggctccatgcagctgcaactaaggaaacatgaccacaaaaccaataaaaaagatgga
ctgagcacagaagcattcattccacaaaccatcgaacagatgagcaaaagtcacacctgt
ggcctgaaagagtcagaaactgggttcatgttttctgatcctccgggacagaaggtaatg
atgagaaatgctgctgacaaggacaaagatttattgcatgtggataccaggaaaagactg
agcacaattgacgagctggacgaactcttccctagcagagattccaatgtgttcattcaa
aattttcttgaaagcaaaaaggagtataacagcattggtgtcagtggctttgagattcgc
tatcctgaaaaacaacaagataaaaaaaacaagaagtcactgataggtggtaaccacagt
aaaattgttgttgaacaaaggaagagtgagtattttgaactgaaggcaaaacttcagagt
tcccccgactacctacaggtccttgaagagcaaacagctttgaacaagatatag

DBGET integrated database retrieval system