KEGG   Mus musculus (mouse): 245450Help
Entry
245450            CDS       T01002                                 

Gene name
Slitrk2, A930040J07
Definition
(RefSeq) SLIT and NTRK-like family, member 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_1 LRRNT
Motif
Other DBs
NCBI-GeneID: 245450
NCBI-ProteinID: NP_001154903
MGI: 2679449
Ensembl: ENSMUSG00000036790
Vega: OTTMUSG00000017614
UniProt: Q810C0 Q14DT0
Structure
PDB: 

Position
X; X A7.1
AA seq 846 aa AA seqDB search
MLSGVWFLSVLTVAGILQTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPP
QYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRPGAFSGLKTLKRLHLNNN
KLEVLREDTFLGLESLEYLQADYNYISTIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRF
VLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNCTCDLLPLKAWLDTITVFVGE
IVCETPFRLHGKDVTQLTRQDLCPRKSASGDSSQRSSHSDTHVQRLTPTTNPALNPTRAP
KASRPPKMRNRPTPRVTVSKDRQSFGPIMVYQTKSPVALTCPSSCVCTSQSSDNGLNVNC
QERKFTNISDLQPKPTSPKKLYLTGNYLQTVYKNDLLEYSSLDLLHLGNNRIAVIQEGAF
TNLTSLRRLYLNGNYLEVLYPSMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLN
NNLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMG
LKDWTEHANSPVIINEVTCESPAKHAGEILKFLGREAICPENPNLSDGTILSMNHNTDTP
RSLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPNVPRNATN
LDVSSFQLQYGSYNTETNDKADGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQDFS
YGNLEEKKEEPATLAYTISATELLEKQATPREPELLYQNIAERVKELPSAGLVHYNFCTL
PKRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPDHPLLQAKPQSEPDYLEVLEKQ
TAISQL
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcggcgtttggttcctcagtgtgttaacagtggccgggatcttacagaccgag
agtcgcaaaactgccaaagacatttgcaagatccgctgcttgtgcgaagagaaggaaaac
gtactgaatattaactgtgaaaacaaaggatttacaactgtcagtttgcttcaacccccc
cagtatcgcatctatcagctgtttctcaacggaaacctcttgaccagactgtatccaaat
gagtttgtcaattattcaaatgcggtgactcttcatctaggtaacaatgggctgcaggag
atccgacctggggcatttagtggtctgaaaactctcaaaagactgcacctcaataacaac
aaactggaggtattgcgagaggacacttttctaggcctagagagtctggagtacctccaa
gctgactacaattacatcagcaccatcgaggcaggggcattcagcaaactgaataagctg
aaagtactcatcctgaatgacaaccttttgctgtctttgcccagtaatgtgtttcggttt
gtcctgctgactcacttagacctgagggggaacaggttgaaagtaatgccttttgctggt
gtccttgaacatattggaggaatcatggaaattcagctggaagaaaacccgtggaattgc
acctgtgacttacttcctctcaaggcatggctggacaccattactgtttttgtgggggag
attgtctgtgaaacccctttcaggttacatgggaaagatgtgacccagctgaccagacaa
gacctctgtcccagaaaaagtgcaagtggtgattctagtcagaggagcagccattcagac
acacatgttcaaaggctgacccctacaacaaatcctgctctcaacccaaccagagctcca
aaagccagccggccacccaaaatgagaaatcgtccgactcctcgagtgactgtgtcaaaa
gaccggcagagctttggcccgatcatggtgtaccagaccaagtcccccgtggccctcacc
tgtcccagcagctgtgtctgtacttctcagagctcagacaatggtctaaatgtgaattgc
caagaaaggaagttcactaacatctctgacctacagcccaaacctaccagtccaaagaaa
ctctacctaacagggaactatctccaaacagtctataagaatgacctcttagaatacagt
tcactggatttgttgcatttaggaaacaacaggattgcagtcattcaggaaggtgccttt
acaaacctgaccagtttacgaagactttatctgaatggcaattaccttgaagtgctgtat
ccttctatgtttgatggactgcagagcttgcagtatctctatttagagtataatgtcatt
aaggaaattaagcctctgacctttgatgctttgattaacctccagctcctgtttctgaat
aacaacctgctgaggtccttacctgataatatatttgggggcacagccctcaccaggctg
aatctgagaaacaatcatttttctcacctgcctgtgaaaggggtcctggaccagcttcct
gcttttatccagatagatctgcaagagaacccatgggactgcacctgtgacatcatgggg
ctaaaggactggaccgaacatgccaattctcctgtcatcatcaatgaggtgacttgtgag
tctcccgctaagcatgcaggggagatactgaaattcctgggaagggaggctatttgtcca
gaaaatcctaacctgtcagatgggactattttgtcaatgaatcacaacacagacacacct
agatcacttagtgtgtctcctagttcttaccccgaactacacactgaagttccactctcc
gttttaattttaggattgcttgtggtttttatcctgtctgtctgttttggggcggggttg
ttcgtctttgttctgaagcgtcgaaagggagtgccaaatgttcccaggaatgccaccaac
ttagatgtaagttccttccagttacaatatgggtcttacaacaccgagactaatgataaa
gctgatggccacgtctataactacattcctccacctgtgggtcagatgtgccaaaacccc
atctacatgcagaaggaaggagacccagtggcctattaccgaaatctgcaggacttcagc
tatggcaacctggaggaaaaaaaagaagaacctgccacacttgcttacacaataagtgcc
actgagttgctagaaaaacaggccacaccaagagagcctgagctgctgtatcagaatatt
gctgagcgagttaaagaacttcccagtgcaggcctagtccactataacttttgtacctta
cctaaaaggcagtttgccccttcatatgaatctcgacgccaaaaccaagacagaatcaat
aaaaccgttttatatgggactcccagaaaatgctttgtggggcagtcaaagccagaccac
cctttactgcaagctaaaccgcaatcggaaccagactacctcgaagttctggaaaaacaa
actgcaatcagtcagctgtga

DBGET integrated database retrieval system