KEGG   Mus musculus (mouse): 245474Help
Entry
245474            CDS       T01002                                 

Gene name
Dkc1, BC068171
Definition
(RefSeq) dyskeratosis congenita 1, dyskerin
  KO
K11131  H/ACA ribonucleoprotein complex subunit 4 [EC:5.4.99.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
Module
mmu_M00425  H/ACA ribonucleoprotein complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    245474 (Dkc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    245474 (Dkc1)
   03032 DNA replication proteins [BR:mmu03032]
    245474 (Dkc1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.-  
     245474 (Dkc1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  Sno RNPs
   Box H/ACA snoRNPs
    245474 (Dkc1)
 Prokaryotic Type
    245474 (Dkc1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    Dyskerin complex
     245474 (Dkc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DKCLD TruB_C_2 TruB_N PUA UPF0113
Motif
Other DBs
NCBI-GeneID: 245474
NCBI-ProteinID: NP_001025478
MGI: 1861727
Ensembl: ENSMUSG00000031403
Vega: OTTMUSG00000020788
UniProt: Q9ESX5
Position
X; X A7.3
AA seq 509 aa AA seqDB search
MADAEVITFPKKHKKKKDRKPLQEDDVAEIQHAEEFLIKPESKVAQLDTSQWPLLLKNFD
KLNVRTAHYTPLPCGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGH
SGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGAL
FQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGLLLGVG
GQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLV
MKDSAVNAICYGAKIMLPGLLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDH
GIVAKIKRVIMERDTYPRKWGLGPKASQKKMMIKQGLLDKHGKPTDNTPATWKQDYIDYS
DSGKNTLVTEAVQAPQLAAEAVNVIKRKRDSESESDETPTVPQLKEKKKKKDKKPKTVLE
SGGETGDGDNDTTKKKKKKKVKVVEEMSE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgcagaagtaattacattcccaaagaagcataagaagaaaaaagaccggaag
ccattacaagaagatgatgttgccgaaatacaacatgctgaagaatttcttatcaaacca
gaatctaaagtggctcaattagacacttctcagtggcccttgttactaaagaattttgat
aagctaaatgtaaggacagcacactatacacctcttccttgtggttcaaatcctctgaag
agggagattggggactatatcaggaccggtttcattaatcttgacaagccctctaacccc
tcttcccatgaggtggtagcctggatccgacgaatacttcgggtagagaagactggccac
agtggcacactagatcccaaagtgactggttgtttaattgtgtgcattgaacgagccact
cgtttggtgaaatcacaacagagtgcaggcaaagagtatgttggaattgtccggctgcac
aatgctattgaagggggtactcagctttctagggccctagaaactctgacaggtgccctg
tttcagcgacccccacttattgctgcagtaaagaggcagcttcgagtgaggactatctac
gagagcaaaatgatagaatatgatcctgagagaagattaggaatcttttgggtaagctgt
gaagctggcacctacattcggacactatgcgtacaccttggcttgttactgggagttggt
ggtcagatgcaggaacttcggagggtgcgttctggagtcatgagtgaaaaggaccacatg
gtgacaatgcatgatgtactcgatgctcagtggctgtatgataaccataaggatgagagt
tacttgcggcgtgttgtttaccctttggaaaagctgttgacatctcataaacgtctggtt
atgaaagatagtgcagtgaatgcaatctgctatggggccaagatcatgcttcctggtctt
cttcgatatgaagatggcattgaggtcaaccaggagattgtggtcattactactaagggg
gaagctatctgcatggcaattgcattgatgactacagcagtgatttctacctgtgaccat
ggtatagtagccaaaataaagagggtgatcatggagagagacacttatcctcgcaagtgg
ggtttaggtccaaaggcaagtcagaagaagatgatgatcaagcagggccttctggacaag
catggcaaacccacagacaatacccctgccacatggaaacaggattacattgactatagt
gattctggcaagaacacactggttaccgaagcagtacaagcccctcagttagctgctgaa
gcagtaaatgtcataaaaaggaagcgggatagtgagagtgaaagtgatgagaccccaaca
gttccccagttgaaggaaaagaagaagaagaaggataagaagcccaaaactgtgctagaa
agtgggggcgaaactggagatggggacaacgacaccaccaaaaagaaaaagaagaagaaa
gtaaaagtggtagaagagatgtctgaatag

DBGET integrated database retrieval system