KEGG   Mus musculus (house mouse): 245526
Entry
245526            CDS       T01002                                 
Symbol
Pgr15l
Name
(RefSeq) G protein-coupled receptor 15-like
  KO
K04210  G protein-coupled receptor 83
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    245526 (Pgr15l)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    245526 (Pgr15l)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    245526 (Pgr15l)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 245526
NCBI-ProteinID: NP_001028533
MGI: 2676330
Ensembl: ENSMUSG00000031212
UniProt: Q80T54
Position
X:96116202..96125710
AA seq 456 aa
MNTSFKGVSPFLSQMESAIDWLGENISWVPSIEDQSCNHTTQNGTNISSAEWGGPTGSVR
RWLGGNPHIMAKIVLTFAYAVIIVISLFGNSLVCQVFVKHKEIKKSTGLLIFNLAISDIL
IILLNSPFALARFLSGQWVFGRIMCHVSRFAQYCSLHVSTLTLMAVAMDRHRVILHPMKP
RLTHSQCLFVVAMIWSIAVFLALPHAIYQNLFTLVNMDGDTRSYCLPSFPGPSILVSKYV
DLGTFILLYILPLLVIVVTYSHLGKRLWIQNAIGDASARQLMAHYQKRKKSIRMLILIVL
VFAVCWFPLNFYVVLISSAGVENDSVLFYAFHWFAMSSTCYNPFIYCWLNRSFRAKLRSI
SSFRMQSLFVCSNSQVQQIKPQESHELRELQTSSLLRVPLAVPEPQVFEDPSLATGDNSQ
VSVQGEWEDPDPTLDEEPGPSTRDTYFCIHMQTSSH
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaacacttccttcaagggagtgtctcctttcctgtcacaaatggaaagtgccattgat
tggctcggagaaaatatcagttgggttccatcaatagaggatcaaagctgcaatcacaca
acccagaatggaaccaatatctccagtgcagaatggggagggccaacaggatcagtcagg
agatggctggggggcaatccccacatcatggcaaagattgtgctgacatttgcatacgct
gtcatcatagtgatatctctctttggcaactccctggtatgccaagtttttgtcaagcac
aaggaaatcaagaaatcaacaggccttctcatcttcaatctggcaatatctgacattttg
ataatcctgctcaacagtccatttgctctggctcgttttctgagtggacagtgggttttc
ggtaggatcatgtgccatgtcagtcggtttgcccagtactgctccctccatgtttcaact
cttacactgatggcagttgctatggaccggcaccgggtaattctgcacccaatgaaacca
aggctaacccactcccaatgcctatttgttgttgccatgatctggagtattgcagtgttc
cttgctctgcctcatgcgatttaccaaaatctgttcactctcgtcaacatggatggtgat
accaggagctactgcctcccttcttttcctggacccagcatactggtttcaaagtatgtg
gacctcgggacatttatcttgttgtatatcctgccacttctggtgattgttgtaacctac
tctcacctaggaaagaggttgtggattcaaaatgctattggtgatgcatctgctcgtcaa
ctcatggcacactaccagaagcgcaagaagagcatccggatgttgatacttattgtattg
gtctttgcagtttgttggtttccacttaacttctatgtggttcttatttccagtgcaggt
gtagaaaatgacagtgtgcttttctatgcctttcactggtttgcaatgagcagcacctgc
tacaatcctttcatatactgttggctcaacaggagcttccgtgccaaactaagatctata
tcatctttcaggatgcaatcactgtttgtgtgtagtaactcccaggttcagcaaataaaa
ccacaggagagtcatgagcttagggagctccagacatcttcactgctacgagttcccctg
gctgtcccagagccccaggtttttgaagatcccagtttggctacaggggataattcccag
gtctctgtccaaggagaatgggaagatccagatcccactctagatgaagaaccagggcct
tcaactcgggatacttacttttgtatccacatgcagactagcagtcactaa

DBGET integrated database retrieval system