KEGG   Mus musculus (mouse): 245527
Entry
245527            CDS       T01002                                 

Symbol
Eda2r, 9430060M22Rik, TNFRSF27, Xedar
Name
(RefSeq) ectodysplasin A2 receptor
  KO
K05163  tumor necrosis factor receptor superfamily member 27
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    245527 (Eda2r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    245527 (Eda2r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    245527 (Eda2r)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   245527 (Eda2r)
SSDB
Motif
Pfam: TNFR_c6 Ephrin_rec_like 7tm_1
Other DBs
NCBI-GeneID: 245527
NCBI-ProteinID: NP_001154904
MGI: 2442860
Ensembl: ENSMUSG00000034457
Vega: OTTMUSG00000018046
UniProt: Q8BX35 Q3KP88
Position
X; X C3
AA seq 297 aa
MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQT
CITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTF
QLSLVKVDAHTVPPREATLVALVGSLLVVFALAFLGLFFLYCKQIFNRHCQCRDSLQYEA
EKTVEEDSLFPVPPGQETSPEFPANEGILEIKPLNSILDDDCSSTRGFPTQESFTMASCA
SESHSQWVHTPIECTELDLQKFSSSIPSTGPETLRENTAEHSGDRLELYVPFEVPSL
NT seq 894 nt   +upstreamnt  +downstreamnt
atggattgtcaagagaatgagtaccgggaccaatgggggcgctgtgtcacctgccaacaa
tgtggccctggacaggagctctcgaaggattgtggttatggagaaggtggagatgcacac
tgcatagtctgccctccccgaaagtataaaagcacttggggacatcacagatgtcagaca
tgcatcacttgtgctgtcatcaatcgggtccagaaggccaactgcacaaatacctctaat
gctatctgtggagactgtctgcccaggttctaccgaaagacacgcattgggggcctgcag
gaccaagaatgcatcccatgtacaaagcagactccttcttccgaggttcagtgtaccttc
cagttgagcttagtgaaggtagatgcacacactgttccccctagggaagccacacttgtt
gcactggtgggaagtctgctagtggtatttgctctggccttccttggactcttcttcctt
tattgcaagcagatcttcaacagacattgtcaatgcagagattcgttgcaatatgaggct
gaaaagacagtggaggaggattctcttttccccgtaccacctggccaggagaccagtcct
gaatttccagctaatgagggcatcttggagatcaaaccacttaactccatcctggatgat
gactgcagctccactcgcggcttccccacccaggagtcctttaccatggcctcctgtgcc
tcagagagccattctcaatgggtccataccccaattgaatgtacagagctggacctgcaa
aagttttccagctctatcccctctactggacctgaaaccttgagagagaacacagctgaa
cactcaggagacaggctggagctctatgtaccttttgaagttcccagcctttaa

DBGET integrated database retrieval system