KEGG   Mus musculus (mouse): 245596
Entry
245596            CDS       T01002                                 

Gene name
Hdx, D030011N01Rik, Gm380
Definition
(RefSeq) highly divergent homeobox
  KO
K24884  highly divergent homeobox
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    245596 (Hdx)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain POU
    245596 (Hdx)
Motif
Pfam: Homeodomain PPV_E1_N
Other DBs
NCBI-GeneID: 245596
NCBI-ProteinID: NP_001074018
MGI: 2685226
Ensembl: ENSMUSG00000034551
Vega: OTTMUSG00000018434
UniProt: Q14B70
Position
X; X E1
AA seq 692 aa
MNLRSVFTVEQQRILQRYYENGMTNQSKNCFQLILQCAQETKLDFSVVRTWVGNKRRKMS
SKSCESGAAGTVSGTSLAAPDITVRNVVNIARPSSQQSSWTSANNDVIVTGIYSPVSSSS
KQGTTKHTNTQITEAHKIPIQKAANKNDTELQLHIPVQRQVAHCKNASVLLGEKTIILSR
QTSVLNAGNSVYNHTKKSYGSSPVQASEMTVPQKPSVCQRPCKIEPVGIQRSYKPEHAGL
ASHNLCGQKPTIRDPCCRTQNLEIREVFSLAVSDYPQRILGGNSTQKPASAEGTCLSIAM
ETGDAEDEYAREEELASMGAQITSYSRFYESGNSLRAENQSTNLPGPGRNLPNSQMVNIR
DLSDNVLYQTRDYHLTPRTSLHTASSTMYSNTNPSRSNFSPHFVSSNQLRLSQNQNNYQI
SGNLSVPWITGCSRKRALQDRTQFSDRDLATLKKYWDNGMTSLGSVCREKIEAVAIELNV
DCEIVRTWIGNRRRKYRLMGIEVPPPRGGPADFSEQPESGSLSALTPGEEAGPEVGEDND
RNDEVSICLSEASSQEESNELIPNETRAHKDEEHQAVSADNVKIEIIDDEESDMISNSEV
EQENSLLDYKNEEVRFIENELEIQKQKYFKLQSFVRNLILAMKADDKDQQQALLSDLPPE
LEEMDCSHASPDPDDTSLSVSSLSEKNASDSL
NT seq 2079 nt   +upstreamnt  +downstreamnt
atgaatctacgttctgtatttactgtagagcaacaaaggattttacagcgttattatgaa
aatggaatgacaaatcaaagtaaaaattgctttcagctcatattacagtgtgcacaggag
actaagctggacttcagtgtagtcaggacgtgggttggcaataagcgaagaaaaatgagt
agtaaaagctgtgaatcaggagcagcaggaactgtgtctggtacctcattggcagcgcca
gacattacagtcagaaatgtggttaatattgcccgcccttcaagccagcaatcttcttgg
acttctgccaataatgatgtcattgtaactggtatatacagtccagtaagctcatcaagt
aagcaaggcactacaaagcatacaaatacacaaattacagaagcacataaaattcctatt
cagaaggcagccaataaaaatgacactgaattacaattgcacattcctgttcaaagacaa
gtagcgcactgtaagaatgcttctgtgctcctaggggaaaagacaattattttgtcaaga
cagacaagtgtactaaatgctggaaactcagtgtacaatcacacaaagaaaagctatgga
agttctccggtgcaagcttcagaaatgacagtacctcaaaagccatctgtgtgccagcga
ccttgcaaaattgaaccagttgggattcaaaggtcatataaacctgaacatgcaggtctg
gcatcacataacttatgtgggcaaaagccaaccattagagacccttgctgtagaacacaa
aacttggaaattcgtgaagtgttttcattggcagtcagtgattaccctcagagaattctg
ggaggaaatagcacacagaagccggcctcagcagaaggaacttgtttgtccattgcaatg
gagactggagacgcagaggatgaatatgccagagaagaagaactggcatcaatgggagca
caaataacaagctactcaaggttttatgaaagtggcaattcccttcgagctgagaaccaa
agtacaaatttgcctggaccaggaagaaacctgccaaattcacaaatggtgaatattaga
gatttgtcagacaatgtactgtatcagactagagactaccatttgacaccacggacctca
ttgcatacagcatctagtactatgtacagtaatactaatccatcacggagtaatttttct
ccacattttgtatcatcaaaccaactgaggttatcacaaaaccaaaacaattaccagatt
tcaggaaacctttctgtgccttggattacagggtgttctaggaaaagagcactacaggac
cgcactcaattcagtgaccgagacttggctactcttaagaagtactgggacaatggtatg
accagcctgggctctgtatgtagagagaagattgaagctgttgcaattgaattaaatgtc
gactgtgaaatagttcggacttggattgggaatcgaagaagaaaataccgtttaatggga
attgaagttccacctccaagaggaggccctgctgatttctctgagcagcctgagtctggt
tctttgtctgcactcacaccaggagaggaagctgggcctgaagtaggagaggataatgac
agaaatgatgaagtgtccatctgtttgtccgaagcaagctctcaagaggagtccaatgaa
cttatcccaaatgagaccagggcacataaggatgaagagcaccaggcagtatctgcagat
aatgtgaaaatagaaattatcgatgatgaagaaagtgacatgataagcaattctgaggta
gaacaagaaaattctctcctggattacaagaatgaagaagtcagatttattgaaaatgag
ctagagattcaaaagcaaaaatactttaagctccagtcttttgttagaaacctgattctc
gctatgaaagctgatgataaagaccagcagcaggcactgctgtcagatttacctccagaa
ttagaagagatggattgcagtcatgcctcgccggatcctgatgatacctcactcagtgtg
tcttctttatcagagaaaaatgcctcagacagcttgtga

DBGET integrated database retrieval system