KEGG   Mus musculus (mouse): 245596Help
Entry
245596            CDS       T01002                                 

Gene name
Hdx, D030011N01Rik, Gm380
Definition
(RefSeq) highly divergent homeobox
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain PPV_E1_N
Motif
Other DBs
NCBI-GeneID: 245596
NCBI-ProteinID: NP_001074018
MGI: 2685226
Ensembl: ENSMUSG00000034551
Vega: OTTMUSG00000018434
UniProt: Q14B70
Position
X; X E1
AA seq 692 aa AA seqDB search
MNLRSVFTVEQQRILQRYYENGMTNQSKNCFQLILQCAQETKLDFSVVRTWVGNKRRKMS
SKSCESGAAGTVSGTSLAAPDITVRNVVNIARPSSQQSSWTSANNDVIVTGIYSPVSSSS
KQGTTKHTNTQITEAHKIPIQKAANKNDTELQLHIPVQRQVAHCKNASVLLGEKTIILSR
QTSVLNAGNSVYNHTKKSYGSSPVQASEMTVPQKPSVCQRPCKIEPVGIQRSYKPEHAGL
ASHNLCGQKPTIRDPCCRTQNLEIREVFSLAVSDYPQRILGGNSTQKPASAEGTCLSIAM
ETGDAEDEYAREEELASMGAQITSYSRFYESGNSLRAENQSTNLPGPGRNLPNSQMVNIR
DLSDNVLYQTRDYHLTPRTSLHTASSTMYSNTNPSRSNFSPHFVSSNQLRLSQNQNNYQI
SGNLSVPWITGCSRKRALQDRTQFSDRDLATLKKYWDNGMTSLGSVCREKIEAVAIELNV
DCEIVRTWIGNRRRKYRLMGIEVPPPRGGPADFSEQPESGSLSALTPGEEAGPEVGEDND
RNDEVSICLSEASSQEESNELIPNETRAHKDEEHQAVSADNVKIEIIDDEESDMISNSEV
EQENSLLDYKNEEVRFIENELEIQKQKYFKLQSFVRNLILAMKADDKDQQQALLSDLPPE
LEEMDCSHASPDPDDTSLSVSSLSEKNASDSL
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaatctacgttctgtatttactgtagagcaacaaaggattttacagcgttattatgaa
aatggaatgacaaatcaaagtaaaaattgctttcagctcatattacagtgtgcacaggag
actaagctggacttcagtgtagtcaggacgtgggttggcaataagcgaagaaaaatgagt
agtaaaagctgtgaatcaggagcagcaggaactgtgtctggtacctcattggcagcgcca
gacattacagtcagaaatgtggttaatattgcccgcccttcaagccagcaatcttcttgg
acttctgccaataatgatgtcattgtaactggtatatacagtccagtaagctcatcaagt
aagcaaggcactacaaagcatacaaatacacaaattacagaagcacataaaattcctatt
cagaaggcagccaataaaaatgacactgaattacaattgcacattcctgttcaaagacaa
gtagcgcactgtaagaatgcttctgtgctcctaggggaaaagacaattattttgtcaaga
cagacaagtgtactaaatgctggaaactcagtgtacaatcacacaaagaaaagctatgga
agttctccggtgcaagcttcagaaatgacagtacctcaaaagccatctgtgtgccagcga
ccttgcaaaattgaaccagttgggattcaaaggtcatataaacctgaacatgcaggtctg
gcatcacataacttatgtgggcaaaagccaaccattagagacccttgctgtagaacacaa
aacttggaaattcgtgaagtgttttcattggcagtcagtgattaccctcagagaattctg
ggaggaaatagcacacagaagccggcctcagcagaaggaacttgtttgtccattgcaatg
gagactggagacgcagaggatgaatatgccagagaagaagaactggcatcaatgggagca
caaataacaagctactcaaggttttatgaaagtggcaattcccttcgagctgagaaccaa
agtacaaatttgcctggaccaggaagaaacctgccaaattcacaaatggtgaatattaga
gatttgtcagacaatgtactgtatcagactagagactaccatttgacaccacggacctca
ttgcatacagcatctagtactatgtacagtaatactaatccatcacggagtaatttttct
ccacattttgtatcatcaaaccaactgaggttatcacaaaaccaaaacaattaccagatt
tcaggaaacctttctgtgccttggattacagggtgttctaggaaaagagcactacaggac
cgcactcaattcagtgaccgagacttggctactcttaagaagtactgggacaatggtatg
accagcctgggctctgtatgtagagagaagattgaagctgttgcaattgaattaaatgtc
gactgtgaaatagttcggacttggattgggaatcgaagaagaaaataccgtttaatggga
attgaagttccacctccaagaggaggccctgctgatttctctgagcagcctgagtctggt
tctttgtctgcactcacaccaggagaggaagctgggcctgaagtaggagaggataatgac
agaaatgatgaagtgtccatctgtttgtccgaagcaagctctcaagaggagtccaatgaa
cttatcccaaatgagaccagggcacataaggatgaagagcaccaggcagtatctgcagat
aatgtgaaaatagaaattatcgatgatgaagaaagtgacatgataagcaattctgaggta
gaacaagaaaattctctcctggattacaagaatgaagaagtcagatttattgaaaatgag
ctagagattcaaaagcaaaaatactttaagctccagtcttttgttagaaacctgattctc
gctatgaaagctgatgataaagaccagcagcaggcactgctgtcagatttacctccagaa
ttagaagagatggattgcagtcatgcctcgccggatcctgatgatacctcactcagtgtg
tcttctttatcagagaaaaatgcctcagacagcttgtga

DBGET integrated database retrieval system