KEGG   Mus musculus (mouse): 245615
Entry
245615            CDS       T01002                                 

Gene name
Kir3dl2, Ki, Kirl2
Definition
(RefSeq) killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu04650  Natural killer cell mediated cytotoxicity
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    245615 (Kir3dl2)
   04612 Antigen processing and presentation
    245615 (Kir3dl2)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    245615 (Kir3dl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    245615 (Kir3dl2)
CD molecules [BR:mmu04090]
 Proteins
  245615 (Kir3dl2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 Ig_4 YajC DUF6377
Other DBs
NCBI-GeneID: 245615
NCBI-ProteinID: NP_808416
MGI: 3612791
Ensembl: ENSMUSG00000057439
Vega: OTTMUSG00000018684
UniProt: Q673W2
Position
X F1; X 58.45 cM
AA seq 388 aa
MLLWFLSLMCSGFFLVQRMSAHVGSHDKPFLYAWPSYVVPLGQNVTLTCDSHRGSNIFKL
YKEEGSPIPQLHETTFQKSQVFGPVTTEHAGTYRCFHPQYANVLSAHSEPLKIIISGIYL
KPFLLILQSPLVNSGGNVTLECHSENMFDTYILISHRMGIIKNSVQVSAEHHESGSHVTY
SIGPMTPDLVGTYTCYGANSYYPYEWSDPSDPIDIKITGVYKKPSLSVLMGPVLMMSGET
MTLSCISDHQFDMFHMSREGVPQGQGMPGVQIHSGKFEAKFLLSSMIQKGNYRCYGSFRN
SSHVWSSPSDPLYLPAKGNCPACTEEDPKIHNCKNLRILTGLLMTMVLVIIIIFYSCYFP
KQNKSQKQAAASMEQESEVKKHNKQTAF
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgctgctctggttcctcagcctcatgtgttctggtttcttcctagtccagaggatgtca
gcacacgtgggaagtcatgataaaccattcctatatgcctggccaagttatgttgttcct
ctgggacagaatgtgactcttacatgtgactctcatagaggatctaacatattcaaactg
tacaaagaagaagggtctccaatccctcagttacatgagactacatttcagaagagccag
gtctttggtcctgtgaccacagaacatgcaggaacctacagatgcttccatcctcaatat
gctaatgtattgtcagcacatagtgagcctctgaaaatcataatttcaggaatctacttg
aagcctttcctcttgattctacaaagtcccctggtgaattcaggagggaatgtgaccctg
gaatgtcactcagagaatatgttcgatacatacattttgatttcacacagaatgggaata
atcaagaactctgtccaagtttctgcagaacatcatgaaagtgggtcacatgtcacctac
tcaataggtcccatgacacctgaccttgttgggacttacacatgctatggtgctaacagt
tactacccctatgaatggtcagaccccagtgaccccattgacatcaagatcacaggtgta
tacaagaaaccttctctgtcagtcctgatggggcctgtgctgatgatgtcaggagaaacc
atgaccctgtcttgcatctctgaccatcagtttgacatgttccatatgtccagggaaggg
gtgcctcagggacaggggatgcctggagtgcagatccacagtggtaaattcgaggcaaaa
ttccttcttagttcaatgatccaaaaggggaactatagatgctatggctctttcaggaac
tcttcccatgtgtggtcctccccaagtgaccccttgtaccttcctgccaaaggaaactgt
cctgcatgcacagaagaagatcccaaaatacataactgcaagaacctgcgcattctaact
gggctcttaatgaccatggtccttgtcatcatcatcatcttttattcttgttactttccc
aaacagaataagtctcagaaacaagcagcagccagcatggaacaagagtctgaagttaaa
aaacacaataaacagacagctttctag

KEGG   Mus musculus (mouse): 245616
Entry
245616            CDS       T01002                                 

Gene name
Kir3dl1, Ki, Kirl1, Kirl2, Krl1
Definition
(RefSeq) killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu04650  Natural killer cell mediated cytotoxicity
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    245616 (Kir3dl1)
   04612 Antigen processing and presentation
    245616 (Kir3dl1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    245616 (Kir3dl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    245616 (Kir3dl1)
CD molecules [BR:mmu04090]
 Proteins
  245616 (Kir3dl1)
SSDB
Motif
Pfam: ig Ig_3 DUF6377 Ig_2 ASFV_J13L Serinc TssO Ly49 YajC DUF2140 Chordopox_A13L Comm FAM176 EphA2_TM
Other DBs
NCBI-GeneID: 245616
NCBI-ProteinID: NP_001297619
MGI: 2652397
Ensembl: ENSMUSG00000031424
Vega: OTTMUSG00000016977
UniProt: Q673W4 D3Z751
Position
X F1; X 58.77 cM
AA seq 316 aa
MLLWFLSLVCSGFFLVQRMSAHLGIYMKPFLLILQSPLVDTGGNVTLECHSENMFDTYIL
ISHRMGIIKNSVQVSAEHHESGSHVSYSIGPMTPDLVGTYTCYGANSYYPYEWSDSSDPI
DIKITGIYKKPSLSALMGPVLMMSGETMTLSCISDHQFDTFHMSREGVPRGQGMPAVQSH
SGKFEAKFLLSPMIQKGNYRCYGSFRNASHVWSSPSDPLYLPAKGNCPAYTEADTKTNNY
KNLHILTGLLVTMVLVVIIIFYSCYFSKQNKSQKQAAASMEQEYEVKNTINTQDFERQEG
QGLHTQNLSRESSTKT
NT seq 951 nt   +upstreamnt  +downstreamnt
atgctgctctggttcctcagcctcgtgtgttctggtttcttcctagtccagaggatgtca
gcacacttgggaatctacatgaagcctttcctcttgattctacaaagtcccctggtggat
acaggagggaatgtgaccctggaatgtcactcagagaatatgttcgatacatacattttg
atttcacacagaatgggaataatcaagaactctgtccaagtttctgcagaacatcatgaa
agtgggtcacatgtcagctactcaataggtcccatgacacctgaccttgttgggacttac
acatgctatggtgctaacagttactacccctatgaatggtcagactccagtgaccccatt
gacatcaagatcacaggtatatacaagaaaccttctctgtcagccctgatgggccctgtg
ctgatgatgtcaggagagaccatgaccctgtcttgcatctctgaccatcagtttgacacg
ttccatatgtccagggaaggggtgcctcggggacaggggatgcctgcagtgcagagccac
agtggtaaattcgaggcaaaattccttcttagtccaatgatccaaaaagggaactataga
tgctatggctctttcaggaacgcttcccatgtgtggtcctccccaagtgaccccttgtac
cttcctgccaaaggaaactgtcctgcatacacagaagcagataccaaaacaaataactac
aagaacctgcacattctaactgggctcttagtaaccatggtccttgtcgtcatcatcatc
ttttactcttgttacttctccaaacagaataagtctcagaaacaagcagcagccagcatg
gaacaagagtatgaagttaaaaacacaataaacacacaggactttgaaagacaagaagga
caggggttacatacacagaacttgagcagagaatcttcaaccaaaacttga

DBGET integrated database retrieval system