KEGG   Mus musculus (mouse): 245688
Entry
245688            CDS       T01002                                 

Gene name
Rbbp7, AA409861, AI173248, AU019541, BB114024, mRbAp46
Definition
(RefSeq) retinoblastoma binding protein 7, chromatin remodeling factor
  KO
K11659  histone-binding protein RBBP7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    245688 (Rbbp7)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     245688 (Rbbp7)
  Chromatin remodeling factors
   NuRD complex
    245688 (Rbbp7)
   NuRF complex
    245688 (Rbbp7)
SSDB
Motif
Pfam: CAF1C_H4-bd WD40 eIF2A ANAPC4_WD40 Capsid_NCLDV
Other DBs
NCBI-GeneID: 245688
NCBI-ProteinID: NP_033057
MGI: 1194910
Ensembl: ENSMUSG00000031353
Vega: OTTMUSG00000017256
UniProt: Q60973 Q8C5H3
Position
X; X F4
AA seq 425 aa
MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDY
ALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKI
NHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGY
GLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHES
LFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALW
DLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAED
GPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTASEL
EGQGS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggcgagtaaagagatgtttgaagatactgtggaggagcgtgtcatcaacgaagagtat
aaaatctggaagaagaatacaccgtttctgtatgacctggttatgacccatgctcttcag
tggcccagtcttaccgttcagtggcttcctgaagtgactaaaccagaaggaaaggattat
gcccttcattggctagtgctgggcactcatacatctgatgagcagaaccatctggtggtt
gctcgagttcatattcccaatgatgatgcacagtttgatgcttcccactgtgacagtgac
aagggagaattcggtggctttggttctgtaacagggaaaattgaatgtgaaattaaaatt
aaccatgaaggagaagtgaatcgtgctcgttatatgccacagaatcctcacatcattgcc
acaaaaacaccatcttctgatgttttggtttttgactatacaaaacaccctgcaaaacca
gatccaagtggagaatgtaatcctgatcttagattaagaggtcaccaaaaggaaggctat
ggtctttcctggaattctaatctgagtgggcatctcctgagtgcatctgatgaccatact
gtctgcctgtgggatataaatgcaggaccaaaggaaggcaaaattgtggatgctaaagca
atctttactggccactcagctgttgtagaggatgtggcctggcatctgctgcatgagtcc
ttgtttggatctgttgctgatgatcagaaacttatgatatgggacaccagatccaatacc
acttctaagccgagccatttggtggatgcacacaccgctgaggtcaactgcctctcattc
aatccctacagcgagttcattctggcaactggctctgcagataagactgtagctttatgg
gacctgcgtaatctgaaactaaaactccacacctttgaatcgcataaggatgaaattttc
caggtccactggtctccacataatgaaactattctggcctcaagtggtactgatcgccgc
ctgaatgtgtgggatttaagtaaaattggagaagaacaatcagcagaagatgcagaagat
gggcctccagagctcctgtttattcatggagggcacactgccaagatttctgacttcagc
tggaatcccaatgaaccttgggtcatttgctctgtgtctgaagataacatcatgcagata
tggcagatggctgaaaatatttacaatgatgaagagtcagatgtcacggcatcggaactg
gaggggcaaggatcttaa

DBGET integrated database retrieval system