KEGG   Mus musculus (mouse): 245839
Entry
245839            CDS       T01002                                 

Symbol
Gzmn, G, GrN
Name
(RefSeq) granzyme N
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Trypsin Trypsin_2
Other DBs
NCBI-GeneID: 245839
NCBI-ProteinID: NP_001292737
MGI: 2675494
Ensembl: ENSMUSG00000015443
UniProt: Q76HN3 Q920S1
Position
14 C3; 14 28.19 cM
AA seq 213 aa
MLPVLILLIFLLPVGDGAEEVIGGHEVKPHSRPYMALVVFLKVNGIGSSCGGFLVQDYFV
LTAAHCIGSSMTVTLGAHNLRAQEETQQIIPVNKALPHPDYNPLDHTNDIMLLKLESKAK
GTRDVRPLKLPGPKDKVNPGDVCSVAGWGKTSINTTEGSALLEEAELIIQENKECKKQFR
HYSKITEICAGDPNKIEAPSKVGIKQFTDKIQG
NT seq 642 nt   +upstreamnt  +downstreamnt
atgctaccagttctgattctcctgatctttcttctgccagtaggagatggagcagaggag
gtcatcgggggccatgaggtcaagccccactctcgcccttacatggcattagttgtgttt
ctgaaagttaatgggattggaagttcctgtggcggcttcctggttcaagactactttgtg
ctgacggctgctcactgcattggaagctcaatgacagtcacactgggggcccacaacctc
cgtgcacaggaggagactcagcagattattcctgtgaataaagctcttccccacccagac
tataatcctctggatcacaccaatgacatcatgctattaaagctggagagtaaggccaag
gggactagagatgtgaggcccctcaagttgcctgggcccaaagacaaggtgaatccaggg
gatgtgtgcagtgtggctggctgggggaaaacgtccatcaataccactgaaggatctgct
ctcttagaagaggctgaattgatcatccaggagaacaaggaatgcaaaaaacaattccgt
cactattccaaaatcacagagatttgtgctggagacccaaacaaaatagaggctccgtcc
aaggtggggatcaagcaattcacagacaaaatccaggggtga

DBGET integrated database retrieval system