KEGG   Mus musculus (mouse): 245841
Entry
245841            CDS       T01002                                 

Gene name
Polr2h
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide H
  KO
K03016  DNA-directed RNA polymerases I, II, and III subunit RPABC3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    245841 (Polr2h)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    245841 (Polr2h)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    245841 (Polr2h)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    245841 (Polr2h)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    245841 (Polr2h)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     245841 (Polr2h)
  RNA polymerase III system
   RNA polymerase III
     245841 (Polr2h)
  RNA polymerase I system
   RNA polymerase I
     245841 (Polr2h)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      245841 (Polr2h)
SSDB
Motif
Pfam: RNA_pol_Rpb8 RNA_pol_RpbG
Other DBs
NCBI-GeneID: 245841
NCBI-ProteinID: NP_663607
MGI: 2384309
Ensembl: ENSMUSG00000021018
Vega: OTTMUSG00000035122
UniProt: Q923G2
Position
16; 16 B1
AA seq 150 aa
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcgggcatcctgttcgaggatattttcgatgtgaaagacatcgacccagaaggcaag
aaatttgaccgagtatcccggctgcactgtgagagtgaatctttcaagatggacctcatc
ttagatgtaaacattcagatttaccctgtggacttaggtgacaagttccggttggttata
gctagtactttgtatgaagatggtaccttggatgatggtgaatacaaccccacagatgac
aggccttccagggctgaccagtttgagtatgtcatgtatgggaaagtgtacaggatcgaa
ggggatgagacctccactgaagcagccacacgcctctctgcgtacgtgtcctatgggggc
ctgctcatgaggcttcagggtgatgccaacaacctgcatggatttgaggtggactccaga
gtttatctgctgatgaagaagctggccttctga

DBGET integrated database retrieval system