KEGG   Mus musculus (mouse): 245860Help
Entry
245860            CDS       T01002                                 

Gene name
Atg9a, AU019532, Apg9l1, Atg9, Atg9l1
Definition
(RefSeq) autophagy related 9A
  KO
K17907  autophagy-related protein 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    245860 (Atg9a)
   04136 Autophagy - other
    245860 (Atg9a)
   04137 Mitophagy - animal
    245860 (Atg9a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    245860 (Atg9a)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    245860 (Atg9a)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    245860 (Atg9a)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   ATG9 transmembrane protein
    245860 (Atg9a)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    245860 (Atg9a)
Transporters [BR:mmu02000]
 Other Transporters
  Others
   245860 (Atg9a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APG9 PRRSV_2b
Motif
Other DBs
NCBI-GeneID: 245860
NCBI-ProteinID: NP_001003917
MGI: 2138446
Ensembl: ENSMUSG00000033124
Vega: OTTMUSG00000048480
UniProt: Q68FE2 Q3ZAQ4
Position
1; 1 C4
AA seq 839 aa AA seqDB search
MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDLFFSRVYNLHQKNGFT
CMLIGEMFELMQFLFVVAFTTFLVSCVDYDILFANKMVNHSLHPTEPVKVTLPDAFLPAQ
VCSARIQENGSLITILVIAGVFWIHRLIKFIYNICCYWEIHSFYLHALRIPMSALPYCTW
QEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEV
VFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRILWIGIANFLL
CPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYLRHFNELEHELQSRLNRGYKP
ASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTV
CRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEEL
LSPIVTPLILIFCLRPRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSGGQT
EASVYQQAEDGKTELSLMHFAITNPGWQPPRESTAFLGFLKEQVQRDGAAAGLAQGGLLP
ENALFTSIQSLQSESEPLSLIANVVAGSSCRGPSLSRDLQGSRHRADVASALRSFSPLQP
GAAPQGRVPSTMTGSGVDARTASSGSSVWEGQLQSLVLSEYASTEMSLHALYMHQLHKQQ
TQAEPERHVWHRRESDESGESAPEEGGEGARAPQPIPRSASYPCATPRPGAPETTALHGG
FQRRYGGITDPGTVPRGPSHFSRLPLGGWAEDGQPASRHPEPVPEEGSEDELPPQVHKV
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggcacagtttgacactgaataccagcgcctagaggcctcctatagcgattcgcccccc
ggggaagaggacctgttggtgcatgtggccgaggggagcaaatcaccttggcaccacatt
gaaaaccttgacctcttcttctctcgagtttataatctccaccagaagaatggcttcaca
tgtatgctcattggagagatgtttgaactcatgcagttcctctttgtggttgccttcacc
accttcctggttagctgtgtggactatgacatcctctttgccaacaagatggtgaaccac
agtctccatcctactgagcctgtcaaggtcactctgccagatgcctttttgcctgcccaa
gtctgtagtgccaggattcaggaaaatggctctcttatcaccatcctggtcattgctggt
gtcttctggatccaccggcttatcaagtttatctataacatttgctgctattgggagatc
cactccttctacctacatgctcttcggatcccaatgtctgcccttccatactgcacatgg
caggaagttcaggcccggattgtgcagacgcagaaagagcatcagatctgcatccacaag
cgtgagctgacagagttggacatctaccatcgcatcctacgtttccagaactacatggtg
gccctggtgaacaaatccctcctgcctctgcgcttccgtctgcccggcctcggagaggtt
gtcttcttcacccgtggcctcaagtacaactttgagctcatcctcttctggggacccggc
tctctgtttctcaatgagtggagcctcaaggccgagtacaaacgtggagggcaacggcta
gagctggcccagcgtctcagcaaccgcatcttgtggattggcatcgccaacttcctgctg
tgtcccctcatcctcatctggcagatcctctatgccttcttcagctatgccgaggtgctg
aagagagagccgggggccctgggagcgcgttgctggtcactctatggccgttgttacctc
cgccacttcaatgagctggagcatgagctgcagtcccgcctcaaccgaggctacaagccc
gcctccaagtacatgaattgcttcttgtcaccgctgctgactctgctggccaagaatggt
gccttcttcgctggctctatcctggctgtgcttattgccctcaccatctatgatgaagat
gtgttagctgtggaacacgtcctcaccacggtcaccctcctgggagtcacggtgactgtg
tgcaggtccttcatcccagaccagcacatggtgttctgccccgagcagctgctccgagtg
attcttgcacacatccactacatgcctgaccactggcagggtaatgcccaccgctcgcag
acccgggacgagtttgcccagctcttccagtacaaggcagtgttcatcttggaggagttg
ctgagtcccatcgtcacacccctcattctcatcttctgcctccgccctcgggccctggag
atcatagacttcttccgcaactttacggtcgaggtcgtgggtgtgggagacacctgctcc
tttgctcagatggacgttcgccagcatggccatcctcagtggctgtctggagggcagaca
gaggcctcagtgtaccagcaagccgaggacgggaagaccgagttgtcgctcatgcacttt
gccatcaccaatcccggctggcagccccctcgtgagagcacagctttcctgggcttcctc
aaggagcaggtgcagcgagatggagcagctgctggcctggcccagggtggcctgctcccc
gagaatgccctcttcacatccatccagtccttacagtctgagtccgagccactgagcctt
attgcaaatgtggtagcaggctcatcctgccgaggaccctcactgtccagagacctgcag
ggctccaggcacagggctgatgttgcttctgcccttcgatccttctcccctctgcagcct
ggagcggcccctcaaggccgggttcccagtaccatgacaggctctggagtggatgccagg
acagccagctctgggagtagcgtgtgggaaggacagctgcagagcctggtgctgtccgaa
tacgcgtccaccgagatgagcctgcacgccctgtacatgcaccagctccacaagcagcag
acccaggctgagcccgagcggcatgtgtggcaccgccgggagagtgatgagagtggagag
agtgcccctgaagaggggggagagggtgcccgggccccccaacccatcccccgctcggcc
agctatccctgtgctacaccccggcctggagcacctgagaccaccgccctgcatgggggc
ttccagaggcgctacgggggcatcacagatcctggcacagtgccccgtggcccctctcac
ttctccaggctgcccctgggaggatgggcagaagatggccagccagcatcaaggcaccca
gagccggtgccagaggagggctcagaggatgaactcccccctcaagtgcacaaggtatag

DBGET integrated database retrieval system