KEGG   Mus musculus (mouse): 245866
Entry
245866            CDS       T01002                                 

Gene name
Ift52, BC037708, NGD5
Definition
(RefSeq) intraflagellar transport 52
  KO
K19681  intraflagellar transport protein 52
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    245866 (Ift52)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Intraflagellar transport (IFT) complex B
    245866 (Ift52)
SSDB
Motif
Pfam: ABC_transp_aux
Other DBs
NCBI-GeneID: 245866
NCBI-ProteinID: NP_742162
MGI: 2387217
Ensembl: ENSMUSG00000017858
Vega: OTTMUSG00000001063
UniProt: Q62559
Structure
PDB: 
5FMS

Position
2; 2 H2
AA seq 426 aa
MEKELRSTILFNAYKKEVFTTNTGYKSLQKRLRSNWKIQSLKDEITSEKLIGVKLWITAG
PREKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVY
YKYFHPKEALVSDGVLNREISRAAGKAVPGVIDEENSGNNAQALTFVYPFGATLSVMKPA
VAVLSTGSVCFPLNRPILAFYHSKNQGFGKLAVLGSCHMFSDQYLDKEENSKIMDVVFQW
LTTGDIHLNQIDAEDPEISDYTMVPDTATLSEQLRVCLQEGDENPRDFTTLFDLSIYQLD
TTCLPKVIKAHEELNVKHEPLQLVQPQFEMPLPALQPAVFPPSFRELPPPPLELFDLDET
FSSEKARLAQITNKCTDEDLEFYVRKCGDILGVTSKLPKDQQDAKHILEHIFFQVVEFKK
LNQEAH
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggagaaggagctgcggagtaccattcttttcaatgcatacaaaaaggaggtgtttacc
accaacactggctacaaatctttgcagaaaagacttcggagtaattggaagattcagagc
ttgaaagatgaaatcacttctgagaagttaattggggtgaaactatggatcacagctgga
ccaagggaaaagtttactgctgctgaatttgaagtcctgaagaagtatcttgacagtggt
ggggatatccttgtgatgctgggagaagggggagaatccagatttgataccaatattaac
tttcttctagaggaatacggaatcatggttaataatgatgctgtggttagaaacgtgtat
tacaagtacttccatcctaaggaagctctggtttcagacggagtgttgaacagagaaatt
agccgagctgcaggaaaggctgtgcctggagtcattgatgaagagaacagtgggaacaat
gcccaggctctcacctttgtctacccttttggtgccacattgagcgtcatgaagccagca
gtggccgtgctatccacaggctctgtctgcttcccactgaacagacccattctagctttc
tatcactcaaagaaccaaggttttggaaagctggcagtgcttggttcgtgtcatatgttc
agtgaccaatatttagataaagaagaaaatagcaaaattatggatgttgtgttccagtgg
cttacaacaggagacatccacctcaaccagattgatgctgaggacccagagatttccgac
tacacgatggtaccagacacagccaccctctcagagcagctccgagtgtgtctgcaggag
ggcgatgagaacccccgtgactttaccaccctctttgacctgtccatttaccagctggac
accacctgcctgcccaaggtcatcaaggctcacgaggaactaaatgtgaaacatgaacca
cttcagctcgtccaacctcagtttgagatgccgctgccagcccttcagcctgcggtcttc
cctccgagtttccgggagttgccgccccctcccctggagctgtttgacctagatgaaaca
ttctcctctgagaaggcgcgcctggctcagatcaccaacaagtgtactgatgaagacctg
gaattctatgtcaggaagtgtggcgacattcttggagtaacaagcaaacttccaaaggat
caacaggatgccaaacatatccttgaacacatcttcttccaagtggtggagttcaagaaa
ctgaaccaggaggcccactga

DBGET integrated database retrieval system