KEGG   Mus musculus (house mouse): 245867
Entry
245867            CDS       T01002                                 
Symbol
Pcmtd2, 5330414D10Rik
Name
(RefSeq) protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 2
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: PCMT SOCS_box DOT1 GCD14 Methyltransf_31
Other DBs
NCBI-GeneID: 245867
NCBI-ProteinID: NP_705822
MGI: 1923927
Ensembl: ENSMUSG00000027589
UniProt: Q8BHD8
Position
2:181471952..181499253
AA seq 359 aa
MGGAVSAGEDNDELIDNLKEAQYIRTDLVEQAFRAIDRADYYLEEFKENAYKDLAWKHGN
IHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVTEY
AKQKLDVFIRTSDSFDKFDFCEPSFVTGNCLEIAPDCCQYDRVYCGAGVQKEHEEYMKNL
LKVGGILVMPLEEKLTKITRTGPSAWETKKILAVSFAPLVQPCRSESGQSRLVQLPPPAV
RSLQDLARLAIRGSIKRAMRQEATRGGGLKNTPMFKRRRVRRRRMETIVFLDKEVFASRI
SNPSDDTSCEDAEEDRREVAERTLQETKPEPPVNFLRQRVLRLPLPDPLKYYLLYYREK
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgggcggtgctgtgagtgctggggaggacaacgatgagctcattgataacttgaaggaa
gcccagtacatccggacggacttagtagagcaggctttccgcgctattgatcgagcagat
tattatcttgaagaatttaaagaaaatgcatacaaagacttggcatggaaacatggaaat
attcatctctcagccccgtgcatctactcggaggtgatggaggctctggatctgcagcct
gggctttcatttctgaatttgggcagtggtactggctacctcagctccatggtggggctc
attctaggtcctttcggcgtgaaccacggggtggagcttcattcagatgtcactgagtac
gcgaagcagaaactggatgtcttcatcagaaccagcgacagctttgacaaatttgacttc
tgtgaaccttcctttgtaactggaaattgcctggagattgctccagattgttgtcagtat
gatcgtgtttattgtggggctggtgtgcagaaagaacatgaagagtacatgaaaaatctt
ctcaaagttggaggcatccttgtcatgcccttggaagagaagttgaccaagataacacgc
acaggtccttctgcttgggagacaaaaaagattctggctgtttcctttgcccctctggtc
cagccttgccgttcggaatcaggacagtccagacttgtccagctaccaccaccagccgtg
cgcagcctacaggacctggcccggcttgctatccgtggcagcatcaagagggctatgcga
caggaagccacaagaggaggtggcctgaagaacacacctatgtttaaaagaaggcgagtc
cgtcgccgcagaatggagaccattgtctttttggacaaagaggtttttgccagtcgaatt
tccaacccctctgatgacaccagctgtgaggatgcagaggaggatcggcgggaagtggca
gagaggaccttacaggagaccaagcctgagccaccagtgaacttccttcgtcagagggta
ttgcgcctcccattgcctgatcccctgaagtactacctgctgtattacagggaaaagtga

DBGET integrated database retrieval system