KEGG   Mus musculus (house mouse): 245877
Entry
245877            CDS       T01002                                 
Symbol
Map7d1, AV028413, BC019977, Mtap7d1, Parcc1, Rprc1, mKIAA1187
Name
(RefSeq) MAP7 domain containing 1
  KO
K16806  MAP7 domain-containing protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    245877 (Map7d1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    245877 (Map7d1)
SSDB
Motif
Pfam: MAP7
Other DBs
NCBI-GeneID: 245877
NCBI-ProteinID: NP_659190
MGI: 2384297
Ensembl: ENSMUSG00000028849
UniProt: A2AJI0
Position
4:complement(126125960..126150112)
AA seq 846 aa
MESGPRVEPGPGAPAAVLARIPQEPRPSPEGDPSPPPPPTPMSALVPDTPPDTPPALKTA
TNPKQLPLEPGNPTGQISPQPAPPQEECPSSEAKSRGPTPTATGPREAKPSRRSSQPSPT
TVPASDSPPAKQDVKKAGERHKLAKERREERAKYLAAKKAVWLEKEEKAKALREKQLQER
RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQQRWSWAGALH
HSSPGRKTSGSRCSVSAVNLPKHVDSIINKRLSKSSATLWNSPSRNRSLQLSAWESSIVD
RLMTPTLSFLARSRSAVTLPRNGRDQGRGSGPGRRPTRARAGASLAPGPHPDRTHPSAAV
PVCPRSASASPLTPCSAPRSAHRCTPSGERPERRKPGAGGSPALARRRLEATPVQKKEKK
DKERENEKEKSALARERNLKKRQSLPASIRPRLSTGSELSPKSKARPSSPSTTWHRPASP
CPSPGPGHALPPKPPSPRGTTASPKGRVRRKEEAKESPSPSGPEDKNHRKSRAAEEKEPA
APASPAPSPVPSPTPAQPQKEQSSTQIPAETAVPAVPAAPTAPPTAAPSVTPSKPMAGTT
DREEATRLLAEKRRQAREQREREEQERKLQAERDKRMREEQLAREAEARAEREAEARRRE
EQEAREKAQAEQEEQERLQKQKEEAEARSREEAERQRQEREKHFQKEEQERQERRKRLEE
IMKRTRKSEAAETKKQDAKETAANNSGPDPVKAVETRPSGLQKDSMQKEELAPQEPQWSL
PSKEMPGSLVNGLQPLPAHQENGFSPKGTAGDKSLGRTAEGLLPFAEAEAFLKKAVVQPP
QVTEVL
NT seq 2541 nt   +upstreamnt  +downstreamnt
atggagagtggcccgcgtgtggagcccggcccgggcgcacccgcagctgtgttagccagg
atcccccaagagccaagaccgtctccggaaggtgacccttcccctcctccgccgccaaca
ccgatgtcagccttggttcctgacactcccccagacacacctcctgccctgaagactgcc
acgaatcctaagcagctcccactggaaccagggaatcccacagggcagatctcacctcag
ccagctcccccacaggaagaatgcccgtcctcagaagccaagagcaggggccccaccccc
acagccacaggaccacgggaggccaagccttctcgaagaagcagccaaccatcccccacc
acagtgccagcctctgacagccctcctgccaagcaagatgtaaagaaggcaggagagaga
cacaagcttgccaaagagcgccgagaagagcgggccaagtacctggcggccaagaaggca
gtgtggttggagaaggaggaaaaagccaaggcgctccgggaaaagcaactccaggagcgc
cgccgacggctggaggagcagcggcttaaagccgaacagcgccgggctgccctggaggag
cggcagaggcagaagcttgagaaaaacaaggagcgctatgaagcagcaatccagcggtca
gtgaagaagacgtgggctgagatccggcaacagcgctggtcctgggcaggggccctgcac
cacagctcccctggacgtaagaccagtgggagcaggtgctccgtgtcggcagtaaacctg
cccaaacacgtggactctataatcaacaagcggctctcaaagtcctctgccacgctctgg
aactcccccagtagaaatcgcagcctgcagctgagcgcatgggagagcagcattgtggat
cgtctgatgacgcccaccctctccttcctggctcggagtcgcagcgcggtcacactgccc
cgcaacggcagggaccagggtaggggcagcggccctgggagacgccccacgagggcccgg
gcaggggccagcctcgcgcccgggccacaccccgaccgcactcatccctctgcagccgtg
ccagtgtgcccgcgctcggcctccgccagccccctgacgccttgtagcgcccctcggagc
gcgcaccgctgcaccccgtccggggagcgcccagagcggcgcaagcccggcgccggtggc
agccccgcgctggcgcgccgccggctggaagccacgccggtgcagaaaaaggagaagaag
gacaaggagcgggaaaacgagaaggaaaagagcgccctggcccgcgaacggaacctcaag
aagcgccagtcgctgccagcgtctatcagacctcggctctccaccggctctgagctcagc
cctaagtccaaggcccggccatcctctccctctacaacctggcacagacctgcctccccc
tgccccagcccaggaccaggacatgcccttcctccaaaaccaccatccccccgaggcacc
actgcatcacccaaggggcgggttcggaggaaggaggaggcaaaagagagccccagcccg
tcggggcctgaggacaaaaaccaccgcaagagtagagccgctgaggagaaggagccagct
gccccagcctcaccagcgccctcaccggtgccctcgcccaccccagcccagcctcagaag
gagcaatcctcaacacagatccctgcagaaactgctgtcccggctgtcccagctgctccg
actgcccctcctaccgctgctccctcggtgacccctagcaaacccatggcgggcaccaca
gaccgagaggaagccacgcggctcctggctgaaaagcggcgccaggctcgggaacagagg
gaacgcgaagaacaggagcggaagctgcaggctgaaagggacaagcgaatgcgagaggag
cagctggcccgggaggctgaagcccgggctgaacgtgaggccgaggcgcggagacgggag
gagcaggaggctcgagagaaggcgcaggctgagcaggaggagcaggagcgactgcagaag
cagaaagaggaagccgaagcccggtcccgggaagaagctgagcgccagcgccaggagcgg
gaaaagcactttcagaaggaggaacaggagagacaagagcgaagaaagcggctggaggag
ataatgaagaggactcggaaatcagaagccgccgaaaccaagaagcaggatgcaaaggag
accgcagctaacaattccggcccagaccctgtgaaagctgtagagactcggccctctggg
ctacagaaggattctatgcagaaagaggagctggccccccaggagccacagtggagcctg
ccaagcaaggagatgccagggtccctggtaaatggcctgcagcctctcccagcgcaccag
gagaacggcttctccccaaagggaaccgctggggacaagagtctgggtcgcacagcagag
gggctcctcccatttgcagaggcagaagccttcctcaagaaagcagtggtgcagcctcca
caggtcacagaagttctttaa

DBGET integrated database retrieval system