KEGG   Mus musculus (mouse): 245880Help
Entry
245880            CDS       T01002                                 

Gene name
Wasf3, Scar3, Wave3
Definition
(RefSeq) WAS protein family, member 3
  KO
K06083  WAS protein family, member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04520  Adherens junction
mmu04666  Fc gamma R-mediated phagocytosis
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    245880 (Wasf3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    245880 (Wasf3)
 09160 Human Diseases
  09161 Cancers
   05231 Choline metabolism in cancer
    245880 (Wasf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    245880 (Wasf3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     245880 (Wasf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH2 ChaB
Motif
Other DBs
NCBI-GeneID: 245880
NCBI-ProteinID: NP_660137
MGI: 2658986
Ensembl: ENSMUSG00000029636
Vega: OTTMUSG00000025851
UniProt: Q8VHI6
Position
5; 5 G3
AA seq 501 aa AA seqDB search
MPLVKRNIEPRHLCRGALPEGVTSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEAN
NFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTIQDQQVVSKNSIPNP
VADIYNQSDKPPPLSILTPYRDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQK
EQKRVDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVHHGASSEGSLSPDTRS
HTSDVTDYSYPATPNHALQAQPATPSYTAGDAPLHGTTNQGAEHEYRPSSASARHMALNR
PQQPPPPPPPQAPEGSQASTSVAPADYGMLPAQIIEYYSPSGPPPPPPPPMIPSAQTAFV
SPLQMPTQPPFPASAVSTYPTPPHQPSTGLLATAPPPPGPPPPPPGPPGPSSLSSSPMHG
PPVAEAKRPEPAQPPISDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSRR
IAVEYSDSDDDSEFDENDWSD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcctttagtgaagagaaacatcgaaccccggcacctgtgccggggcgccctgccggaa
ggagtcaccagtgagctggaatgcgtgaccaacagcacgctcgctgcaatcatccgccag
ctgagcagtctgagtaaacatgcagaagacatatttggtgagttatttaatgaggctaac
aacttctacatcagagcaaattcccttcaagacagaatcgatcggcttgctgtcaaagtc
acccagctggactccacggtggaggaggtctcactacaggatatcaacatgaagaaagca
ttcaaaagctctaccatccaagaccagcaggtggtctccaagaacagcattcccaaccct
gttgctgacatttataatcagagtgacaaacccccgccgctgagcattctgacaccgtac
agagatgacaagaaggatgggctgaagttctacacggatccctcttacttctttgacctc
tggaaagaaaagatgctgcaggacacagaagacaagaggaaagagaaacgacgtcagaag
gaacaaaagcgtgtagatggcaccacccgagaggtgaaaaaggttagaaaagccagaaac
aggcgccaggagtggaatatgatggcgtatgacaaggagcttaggcccgacaacaggttg
tctcagagtgtgcaccacggagcatcctccgagggatctctgtccccagatactaggtct
cacacatccgatgtcaccgattattcttatcctgctactcccaaccatgctttgcaagca
cagccggcgacaccctcctacacagctggcgatgcaccactgcatgggaccacaaaccaa
ggcgctgagcacgagtaccgaccgtcgtctgcctcggcaaggcacatggccctgaacaga
cctcagcagccaccgccaccgcctcctccccaggcgccggaggggtcccaggcctctacg
tcagtggctccagccgactatgggatgcttccagcacagataattgaatactacagcccc
tcaggaccgccaccacctccccctccacccatgattccctcagcacaaactgccttcgtc
agccctctccagatgcccacacagcccccgttccctgcctcagccgtctccacatacccc
actcctcctcaccagccctccactgggctcctggccacagcaccaccacccccaggtccc
ccacctcctccacctggtcctcctggcccctcctccctatcatcgtccccaatgcatggt
ccccctgtggctgaggcaaagcgcccagagcctgcacagccacccataagtgatgcgaga
agtgacctcttggctgccatccggatgggaatccaactgaaaaaggtgcaggagcaacgc
gagcaggaagccaagcgggagcctgtcgggaatgacgtggccaccatcttgtctagacgc
attgctgtggagtacagcgactcagacgacgactctgagtttgatgagaatgactggtct
gactga

DBGET integrated database retrieval system