KEGG   Mus musculus (house mouse): 245886
Entry
245886            CDS       T01002                                 
Symbol
Ankrd27, AA408090, BC016493, D330003H11Rik, Varp
Name
(RefSeq) ankyrin repeat domain 27 (VPS9 domain)
  KO
K20175  ankyrin repeat domain-containing protein 27
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    245886 (Ankrd27)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    245886 (Ankrd27)
 Others
  Rab GTPases of specific organelles
   Melanosome
    245886 (Ankrd27)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_3 Ank_5 VPS9 Ribonuc_red_sm IDO
Other DBs
NCBI-GeneID: 245886
NCBI-ProteinID: NP_663608
MGI: 2444103
Ensembl: ENSMUSG00000034867
UniProt: Q3UMR0
Position
7:35285652..35338662
AA seq 1048 aa
MALYDEDLLKNPFYLALQKWRPDLCSKVAQIHGIVLVPCRGSLPGSVQASCQFESYVLVP
TEGHFQTLDGKAVVIEGNRIKLGAGFACLLSVPILFEETFYNEKEESFSILCIAHPLERR
ETSEEPSAPADPFSLKTIEDVREFLGRHSEKFDKNIASFHRTFRECERKSLRHHIDSVNA
LYTKCLQQLLRDSHLKVLAKQEAQMNLMKQAVEMYVHHDIYDLIFKYVGTMEASEDAAFN
KITRSLQDLQQKDIGVKPEFSFNIPRAKRELGQLNKCTSPQQKLLCLRKVVQLMTQSPSQ
RVNLETMCADDLLSVLLYLLVKTEIPNWMANLSYIKNFRFSSSAKDELGYCLTSVEAAIE
YIRQGSLSTKTPDAEGFGDRLFLKQRMNLLSQMTSTPIDCLFKHIASGNQKEVERLLSQD
DQDKDAMQKMCHPLCSCEDCEKLISGRLNDPSVVTPFSRDDRGQTPLHVAALCGQASLID
FLVSKGAVVNATDYHGSTPLHLACQKGFQSVTLLLLHYKASTEVQDNNGNTPLHLACTYG
QEDCVKALVYYDVQACRLDIGNEKGDTALHIAARWGYEGIIETLLQNGAPTAVQNRLKET
PLKCALNSKILSIMEAHHLSSDRRPRPSEVPAQSPTRSVDSISQGSSTSSFSSISVSFRQ
EEVKKDYREVEKLLRAVADGDLEMVRYLLEWTEDDLDDVEDAISTVDLEFCHPLCQCPKC
APAQKLARISANGLSVNVTNQDGFSPLHMAALHGRTDLVPLLLKHGAYSGARNTSQAVPL
HLACQQGHFQVAKCLLDSNAKPNKKDLSGNTPLICACSAGHHEVAALLLQHGASINACNN
KGNTALHEAVMGRHTLVVELLLFYGASVDILNKRQYTAADCAEQDSKIMELLQVVPGCVA
SLDSVEEADHEGYVTVEIRRKWNPKMYNLPEEPLRRQFCLINPGGRFQERTSRETMGRDR
SVPDLAGRSLQEPEKQRVTGKQSDLSDLSRYQTSEEGNKGLPERPVSRQAAPGHRPMVRR
HTVNDAAILQVPEVTVHLTTHEASVPQS
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggctctatatgatgaagatctcctgaaaaaccctttctacctggcccttcagaagtgg
cgccccgacttgtgcagcaaggtggcccagatccatggcattgtcctagtgccttgcaga
ggaagcctgcccggcagtgtgcaggcctcctgccagttcgagtcctatgttttggtaccc
acggaaggacactttcagaccttagatggaaaggctgtcgtcattgaaggaaacaggatt
aagctaggagcaggttttgcttgccttctctctgtgcccatcctctttgaggagactttc
tacaacgagaaagaggagagtttcagcattctctgcattgctcatcctttggagaggaga
gagacttcagaagaaccttcagcgcctgcagatcctttctccctgaaaaccatcgaagat
gtgagagaatttttgggaagacactcagagaaatttgacaagaacattgcctctttccac
cggacgttccgagaatgtgaaagaaagagcctccgccaccacatagactccgtaaatgct
ctctacaccaaatgcctccagcagcttctccgagactctcacctgaaggttcttgcaaag
caggaggcccagatgaacctgatgaagcaggccgtagagatgtatgtccatcacgatatt
tacgacctgatctttaaatacgtggggaccatggaggcgagcgaggatgccgcctttaac
aaaatcacgagaagccttcaagatctccagcagaaagacatcggcgtgaaacccgagttc
agcttcaacatccctcgggcaaagagagagctgggtcagttgaacaagtgtacgtcgcca
cagcagaagctgctgtgcctgaggaaggtggtccagctcatgacacaatctcccagccag
agagtgaacttggagaccatgtgtgccgatgatctcctctcggtcctgttatatctgctc
gtgaagacagagatccctaactggatggcaaatttgagctacatcaaaaacttcagattt
agcagctcggccaaagatgagctaggatactgcctgacctcagtcgaggctgcgattgaa
tacatccggcaaggaagtctctccacgaagacgcctgacgctgagggatttggcgacaga
ctatttctcaagcagcggatgaacttgctgtcccagatgacatcaacacccatcgactgc
ctgttcaagcacatcgcctctggtaaccaaaaggaagtggaaagacttctgagccaagat
gaccaggacaaagacgccatgcaaaagatgtgccacccactttgttcctgtgaggactgt
gagaagcttatctctgggaggctgaatgacccgtcagttgtcactcctttctccagagat
gacagaggtcaaacacccctccatgtggctgccctctgtggtcaggcatccctcattgac
ttcctggtctccaaaggtgccgtagtgaacgccacagactatcatgggtccaccccctta
catctggcatgtcagaaaggcttccaaagtgtgacgctgctgctgctgcactacaaggcc
agcactgaggttcaggacaacaacggcaacaccccgctgcacctggcctgcacctatggg
caggaggattgcgtgaaggccctggtctactatgatgtccaggcctgcagattggatatt
ggtaatgagaaaggagacacagccctgcacattgctgcacgctggggttacgagggcatc
atagagacactgctgcagaatggagcccccacagcagtccagaacagactgaaggaaaca
ccactcaagtgtgctctgaactcgaagattctgtctatcatggaagctcatcacctatcc
tctgacaggaggccaaggccttctgaggttcctgcacagtcccctacacgctctgtggat
tccatcagccagggctcctccacctccagcttttcttccatatcggtgagcttcaggcaa
gaagaggtcaaaaaggactacagggaggtagaaaagcttctaagggcagttgctgatggc
gatctagaaatggtacgataccttttggagtggacagaggatgacctagacgatgtggaa
gacgccatcagcacggtggatctcgaattctgtcaccccttatgccagtgtcccaagtgt
gctccagctcagaaactggccaggatttctgccaatgggcttagtgtgaatgtgaccaac
caggacggcttctctcccctgcacatggctgccctgcatggccgcacagacctcgtcccc
ctcctgctgaagcacggtgcttactcaggtgccagaaacacaagccaagccgtcccgctc
cacctggcctgccagcaggggcactttcaggtggcaaaatgtctcttagattccaatgca
aaacctaataaaaaggacctcagtgggaacacacccctcatttgtgcctgctctgccggc
caccatgaagtcgctgcgctgttgctacagcacggggcctccatcaatgcttgcaacaac
aaaggcaacacggccctgcatgaggctgtgatgggaaggcacaccctggtagtggagctg
cttctgttctacggggcgtcggttgacatcctgaacaagaggcagtacacggcggcggac
tgtgccgagcaggactcaaaaataatggagttgctgcaggtagtgccaggctgtgttgcg
tctctagacagcgtcgaggaggcagaccacgagggttacgtgactgttgagatcaggaga
aaatggaaccccaaaatgtacaacctgccagaggaacctcttaggagacagttttgcctc
attaacccggggggtcggttccaggagaggacatccagggagactatgggaagggataga
agtgtgcccgatcttgcaggacgttctcttcaggagccagagaagcaaagagtcaccgga
aagcagagtgacctgtcagacctgagcaggtatcagacctctgaggaaggaaacaagggg
ctcccggagaggcccgtgtcgagacaggctgctccaggacaccggccgatggtccgcaga
cacacagtcaatgacgcagccatactccaggtcccagaggtgactgtccacctcaccacc
cacgaggcgagtgttcctcagtcttag

DBGET integrated database retrieval system