KEGG   Mus musculus (mouse): 246104Help
Entry
246104            CDS       T01002                                 

Gene name
Rhbdl3, AI847581, Rhbdl4, Rhomr1, Vrho
Definition
(RefSeq) rhomboid like 3
  KO
K02857  rhomboid-related protein 1/2/3 [EC:3.4.21.105]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    246104 (Rhbdl3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.105  rhomboid protease
     246104 (Rhbdl3)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S54: Rhomboid family
   246104 (Rhbdl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rhomboid EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_11 DUF5580 DUF3087
Motif
Other DBs
NCBI-GeneID: 246104
NCBI-ProteinID: NP_631974
MGI: 2179276
Ensembl: ENSMUSG00000017692
Vega: OTTMUSG00000000214
UniProt: P58873
Position
11; 11 B5
AA seq 404 aa AA seqDB search
MGEHPSPGPAVAACAEAERIEELEPEAEERLPAAPEDHWKVLFEKFDPGSTGYISTGKFR
SLLESHSSKLDPHKKEVLLALADSHADGQICYQDFVNLMSNKRSNSFRQAILQGNRRLSS
KALLEEKGLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPPWFMITITLLEVALFLYN
GVLLDQFVLQVTHPRYLKNSLVYHPQLRAQAWRYVTYIFMHAGVEQLGLNVALQLLVGVP
LEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMK
CQFKLLRMAVALICMSMEFGRAVWLRFHPSAYPPCPHPSFVAHLGGVAVGITLGVVVLRN
YEQRLQDQSLWWIFVTMYTIFVLFAVFWNIFAYTLLDLKLPPAP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcaccccagccccggccccgcagtggccgcctgcgcggaggctgagcgcatc
gaggagctggagcccgaggccgaggagcgactgcccgccgcgccagaagaccactggaaa
gtcctgtttgaaaagtttgaccctggaagcaccggctacatcagcacaggaaagttccgg
agcctcctggagagccacagctctaagctggacccacacaaaaaggaggtgctcctggct
ctcgcagacagccatgcagatgggcagatctgctaccaggactttgtcaacctgatgagc
aacaaacgttccaacagcttccgccaggccatccttcagggaaaccgcaggctgagcagc
aaggccctgctggaggagaaggggctgagcctctctcagcggctcatccgccacgtggcc
tacgagactctgccccgggagattgaccgcaagtggtactatgacagctacacctgctgc
cctccgccctggttcatgatcacaatcacgctgctggaggttgcccttttcctgtacaac
ggggtcctactagatcagtttgtgctgcaggtgacgcaccctcgatacctgaagaactct
ctggtttaccacccgcagctccgtgcgcaggcttggcgctatgtgacgtacatcttcatg
catgcaggggtggaacagctgggactcaatgtggcactgcagctgctggtaggggtaccc
ctggagatggtgcatggagccacccgaattgggcttgtctacgtggccggtgttgtggca
ggctccttggcggtgtctgtggctgacatgactgcacctgttgtgggctcttccggaggg
gtgtatgcgctcgtctctgcccacctagccaacattgtcatgaactggtcaggcatgaag
tgccagttcaagctgctgcggatggctgtggccttgatctgtatgagtatggagttcgga
agggctgtatggctccgtttccacccatcggcttatcccccgtgcccccacccaagcttt
gtggcacacttgggtggcgtggccgtgggcatcaccctgggcgtggtggttctcagaaat
tacgagcagaggctgcaggaccagtcgctgtggtggatctttgtgaccatgtacaccatc
ttcgtgctgtttgctgtcttctggaacatctttgcctacacactgctggacttgaagctg
ccacccgccccctaa

DBGET integrated database retrieval system