KEGG   Mus musculus (house mouse): 246133
Entry
246133            CDS       T01002                                 
Symbol
Kcne2, 2200002I16Rik, AW048273, MiRP1
Name
(RefSeq) potassium voltage-gated channel, Isk-related subfamily, gene 2
  KO
K04896  potassium voltage-gated channel Isk-related subfamily E member 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    246133 (Kcne2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    246133 (Kcne2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   246133 (Kcne2)
SSDB
Motif
Pfam: ISK_Channel EMP70
Other DBs
NCBI-GeneID: 246133
NCBI-ProteinID: NP_598871
MGI: 1891123
Ensembl: ENSMUSG00000039672
Vega: OTTMUSG00000019966
UniProt: Q9D808 A0A0R4J1J2
Position
16:92089277..92095021
AA seq 123 aa
MATLANLTQTLEDAFKKIFITYMDSWRRNTTAEEQALQARVDAENFYYVILYLMVMIGMF
SFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQEKYKSQILHLEDSKATIHENMGATGFT
VSP
NT seq 372 nt   +upstreamnt  +downstreamnt
atggccacattagccaatttgacccagacactggaggatgccttcaaaaagatttttatt
acttatatggacagctggaggaggaacacgacagccgaggagcaggcactccaggccaga
gtggatgccgagaacttctactacgtcatcctgtacctcatggtgatgatcggcatgttc
tcgttcatcgtggtggccatcctggtgagcacggtgaagtcgaagcggcgagagcactcc
caggacccgtaccaccagtacatcgtggaagattggcaggaaaagtacaaaagtcagatc
ctgcatctggaagactccaaggccaccatccatgagaacatgggggcgacggggttcaca
gtgtcaccctga

DBGET integrated database retrieval system