KEGG   Mus musculus (mouse): 246221Help
Entry
246221            CDS       T01002                                 

Gene name
Mpst, Mst
Definition
(RefSeq) mercaptopyruvate sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00270  Cysteine and methionine metabolism
mmu00920  Sulfur metabolism
mmu01100  Metabolic pathways
mmu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    246221 (Mpst)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    246221 (Mpst)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    246221 (Mpst)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     246221 (Mpst)
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     246221 (Mpst)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-GeneID: 246221
NCBI-ProteinID: NP_001155964
MGI: 2179733
Ensembl: ENSMUSG00000071711
UniProt: Q99J99
Structure
PDB: 

Position
15; 15 E1
AA seq 297 aa AA seqDB search
MAAPQLFRALVSAQWVAEALKAPRSSQPLKLLDASWYLPKLGRDARREFEERHIPGAAFF
DIDRCSDHTSPYDHMLPNATHFADYAGSLGVSAATHVVIYDDSDQGLYSAPRVWWMFRAF
GHHSVSLLDGGFRHWLNQNLPISSGKSHSEPAEFSAQLDPSFIKTHEDILENLDARRFQV
VDARAAGRFQGTQPEPRDGIEPGHIPGSVNIPFTEFLTNEGLEKSPEEIKRLFKEKKVDL
SKPLVATCGSGVTACHVVLGAFLCGKSDVPVYDGSWVEWYMRAQPEHIISEGRGKTQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccgcaacttttccgagctctggtgtctgcgcagtgggtggcggaggctctg
aaggccccgcgctcctcacagccgctgaagttactggacgcgtcctggtacctacccaag
ctgggccgcgatgcacgacgcgagtttgaggagcgccacatcccgggcgccgccttcttc
gacatcgatcgttgcagtgaccacacgtccccctacgaccacatgctgcctaacgccacg
cactttgccgactacgcgggcagcttgggcgtgagcgccgccacgcacgtcgtgatctac
gacgacagtgaccagggcctctattccgctccgcgggtctggtggatgttccgcgccttc
ggccaccactctgtgtcattgctggacggcggcttccgccactggctgaatcagaacctg
ccaatcagctccggcaaaagccactcggagcccgcggagttcagcgcgcagctcgatccc
tctttcatcaagacccacgaggacatcctggagaacttggatgcccggcgcttccaggtg
gtggacgcccgcgcagctggccgtttccaaggcacccagccagaaccccgagatggcatc
gaacctggccacatccctggctcagtaaacatcccgttcactgaattcctgaccaacgaa
ggcctggagaagagcccagaggagatcaaacgcctgtttaaggagaagaaggtggacctg
tctaagcccttggtagccacgtgtggctccggtgtcacagcctgccacgtggtcctgggg
gccttcctctgtggcaagtcagacgtgcctgtctatgatggctcctgggtagagtggtac
atgcgtgcccagccagagcatatcatctctgagggccgagggaagacccagtga

DBGET integrated database retrieval system